TkA04G496580 | RubberDandelionOmics

Gene overview

TkA04G496580

Reference: TK1151 Chr: Chr04 Coordinates: 125395577-125397970 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

967 bp · TkA04G496580|TK1151|cDNA

ATTATCTTTAGCTAGATTCTCCCTTCTATCTTCTAAGCTGTCAAAAATAAAGTTAACAATTATTGCTCTCATCGTTTCTCCAAATATTCCACCTTTGTCATGGCCACGACAGACTACATATCGGTGATTGGTATGATGATGGTCATCTTCTTCTCATCCTTTGTTTGGGCAGATCCCGATATGCTACAAGATGTTTGTCCTGCAAATCTTGCCTCTGACGTCACAATAAATGGATTTGCATGCAAACGTGATGCTTCAGC...

CDS

Download CDS FASTA

672 bp · TkA04G496580|TK1151|CDS

ATGGCCACGACAGACTACATATCGGTGATTGGTATGATGATGGTCATCTTCTTCTCATCCTTTGTTTGGGCAGATCCCGATATGCTACAAGATGTTTGTCCTGCAAATCTTGCCTCTGACGTCACAATAAATGGATTTGCATGCAAACGTGATGCTTCAGCCCATGATTTCTTCTTCGATGGGCTAGTAAACCCAAGATCCACCGACAACATATATAAAGCGACAGTTACACTAGTCATGGTCCAAAATTTCACCGGCCT...

Protein

Download Protein FASTA

223 aa · TkA04G496580|TK1151|PROTEIN

MATTDYISVIGMMMVIFFSSFVWADPDMLQDVCPANLASDVTINGFACKRDASAHDFFFDGLVNPRSTDNIYKATVTLVMVQNFTGLNTMGMTLGRIDFAPGGLNPPHSHPRASEIFFLMEGKLDVAFITTDNKLYSKTVKSGEQFVFPRGLMHYQINNGKVPAVAFAIFNSQSPGVQRAATALFASSPSVPNPVLAKAFGIGINEVKKIKSRLAPQNFPRSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G496580`
TK1151 ID	TkA04G496580
OH-1004 ID	LXL04_039013
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.500
Protein coverage (%)	TK1151 97.309 / OH-1004 99.543 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G496580

Location Chr04:125395577-125397970 (+)

Description Similar to Os05g0277500: Germin-like protein 5-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62020`	May play a role in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0277500`	May play a role in plant defense.	No verified direct reference in this release
`Os01g0284500`	May play a role in plant defense.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039013 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004784 superoxide dismutase activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G09560

ath:AT3G62020

dosa:Os05g0277500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.784

Rank 1 · TkA04G496580 · TK1151

Lysosome / Vacuole0.060

Rank 2 · TkA04G496580 · TK1151

Endoplasmic reticulum0.058

Rank 3 · TkA04G496580 · TK1151

Cytoplasm0.052

Rank 4 · TkA04G496580 · TK1151

Cell membrane0.046

Rank 5 · TkA04G496580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_163-208 aa

PF11699CENP-C_C89-161 aa

PF07883Cupin_296-170 aa

PF12973Cupin_797-126 aa

PF19480DUF6016100-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G496580	`PF00190`	Cupin_1	63	208	4.5e-43	147.1
TkA04G496580	`PF11699`	CENP-C_C	89	161	0.1	13.6
TkA04G496580	`PF07883`	Cupin_2	96	170	1.2e-11	44.9
TkA04G496580	`PF12973`	Cupin_7	97	126	0.21	12.1
TkA04G496580	`PF19480`	DUF6016	100	137	0.009	16.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M263`	Arabidopsis thaliana	sp\|Q9M263\|GL24_ARATH Germin-like protein subfamily 2 member 4	54.100%	Swiss-Prot	High
`Q6I544`	Oryza sativa subsp. japonica	sp\|Q6I544\|GL52_ORYSJ Germin-like protein 5-1	57.500%	Swiss-Prot	High
`Q7F731`	Oryza sativa subsp. japonica	sp\|Q7F731\|GL11_ORYSJ Germin-like protein 1-1	57.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card