RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G495510
Reference: TK1151 Chr: Chr04 Coordinates: 125130099-125135350 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3915 bp · TkA04G495510|TK1151|cDNA

CTCCCACTTACCAAAATATACATATATATATCTATATATTATATATACATGTCAGTATAATTGATTGGAGTGTAGTGGGGTATGGCCTCTTCAGCTGAGATTGTAGGTGTGGACCTGTGCTGTATACCCTCAATCGATTTAAGTCGATGATCGAGGTTTTTGCAGAACCGGGGCTGCGATTTTCAAGTATAGTGATGGGTTTTAGTGTCCTTTTCACTTGATCCGAAAAAACCTTCCAATCTTTCAACTACTTGAAGCTG...

CDS

Download CDS FASTA

3381 bp · TkA04G495510|TK1151|CDS

ATGTCTACATCAAGGCCAAATGATCAATCATCCACCAATTCCGCAAGATCAAAACACAGTGCAAGAATCATCCACCAAACAACCGTAGACGCGAAGCTCCATGCTGACTTCGAAGAATCCGGCGACTCATTCGACTACTCAAGCTCCGTTCATGTCACCAGCACGGTGGTTGGCGGCGAACAGCCTCGCTCCGATAAGGTCACCACCGCGTACCTCCACCACATCCAAAAGGGGAAACTAATCCAACCTTTCGGATGCTT...

Protein

Download Protein FASTA

1126 aa · TkA04G495510|TK1151|PROTEIN

MSTSRPNDQSSTNSARSKHSARIIHQTTVDAKLHADFEESGDSFDYSSSVHVTSTVVGGEQPRSDKVTTAYLHHIQKGKLIQPFGCLLALDEKTFKIIAYSENAPEMLTMVSHAVPSVGENPLLGIGTDVRTIFAGPSANALYKALGFGEVSLLNPILVHCKTSGKPFYAIIHRVTGSLIIDFEPVMPNEVPMTAAGALQSYKHAAKAIARLQSLPSGSIERLCDTMVQEVFELTGYDRVMAYKFHDDDHGEVVAEITKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G495510
TK1151 IDTkA04G495510
OH-1004 IDLXL04_037978
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)52.300
Protein coverage (%)TK1151 98.401 / OH-1004 97.056
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G495510
LocationChr04:125130099-125135350 (+)
DescriptionSimilar to PHYC: Phytochrome C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g09570 Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region.
Arabidopsis fhl/fhy1 double mutant reveals a distinct cytoplasmic action of phytochrome A.2007 · DOI: 10.1073/pnas.0703855104
Phytochrome A mediates rapid red light-induced phosphorylation of Arabidopsis FAR-RED ELONGATED HYPOCOTYL1 in a low fluence response.2009 · DOI: 10.1105/tpc.108.061259
FAR-RED ELONGATED HYPOCOTYL1 and FHY1-LIKE associate with the Arabidopsis transcription factors LAF1 and HFR1 to transmit phytochrome A signals for inhibition of hypocotyl elongation.2009 · DOI: 10.1105/tpc.109.067215
Missense mutation in the amino terminus of phytochrome A disrupts the nuclear import of the photoreceptor.2012 · DOI: 10.1104/pp.111.186288
PHYTOCHROME INTERACTING FACTOR8 Inhibits Phytochrome A-Mediated Far-Red Light Responses in Arabidopsis.2020 · DOI: 10.1105/tpc.19.00515

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037978 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009584 detection of visible light Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0009637 response to blue light Biological Process
GO:0017006 protein-tetrapyrrole linkage Biological Process
GO:0005634 nucleus Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0000155 phosphorelay sensor kinase activity Molecular Function
GO:0009881 photoreceptor activity Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference
ath:AT5G35840
dosa:Os03g0752100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458
Rank 1 · TkA04G495510 · TK1151
Nucleus0.276
Rank 2 · TkA04G495510 · TK1151
Cell membrane0.197
Rank 3 · TkA04G495510 · TK1151
Golgi apparatus0.089
Rank 4 · TkA04G495510 · TK1151
Endoplasmic reticulum0.088
Rank 5 · TkA04G495510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08446PAS_270-186 aa
PF01590GAF220-402 aa
PF00360PHY416-591 aa
PF00989PAS622-736 aa
PF13188PAS_8625-671 aa
PF08448PAS_4629-740 aa
PF13426PAS_9634-738 aa
PF08446PAS_2651-683 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G495510PF08446PAS_2701865.4e-38130.7
TkA04G495510PF01590GAF2204029.9e-1556.0
TkA04G495510PF00360PHY4165911.5e-52178.4
TkA04G495510PF00989PAS6227361.9e-42144.6
TkA04G495510PF13188PAS_86256710.0002321.7
TkA04G495510PF08448PAS_46297401.6e-0732.2
TkA04G495510PF13426PAS_96347389.2e-0936.2
TkA04G495510PF08446PAS_26516835.4e-38130.7
TkA04G495510PF00989PAS7528741.9e-42144.6
TkA04G495510PF13426PAS_97678739.2e-0936.2
TkA04G495510PF08448PAS_47778071.6e-0732.2
TkA04G495510PF13188PAS_87788190.0002321.7
TkA04G495510PF00512HisKA8989561.1e-0938.9
TkA04G495510PF12763EH9239700.08313.5
TkA04G495510PF08446PAS_296510015.4e-38130.7
TkA04G495510PF02518HATPase_c100811186.7e-1040.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P14712Arabidopsis thalianasp|P14712|PHYA_ARATH Phytochrome A74.800%Swiss-ProtHigh

JBrowse

View in Genome Browser