TkA04G488710 | RubberDandelionOmics

Gene overview

TkA04G488710

Reference: TK1151 Chr: Chr04 Coordinates: 123573341-123575268 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

417 bp · TkA04G488710|TK1151|cDNA

ATGAAAGGTGAACACATATGCTGTAGTAAAGGAGAAGTCAAGAAAGGGCCATGGTCGGCTGAAGAAGATAAATTACTTTTTAATTACGTTACAAATCATGACCAATTTCATTGGAGCTCCGTTCCCGAACAAAGTGGGTTGAAAAGATGTGGGAAGAGTTGCCGATTGAGATGGCTCAATTATTTGCACCCAGATCTTAAGCATGGAAATTTCAGTGCAGAAGAAATAGATCTTATATTTAGGGTTCAAAAGGATATCGG...

CDS

Download CDS FASTA

417 bp · TkA04G488710|TK1151|CDS

ATGAAAGGTGAACACATATGCTGTAGTAAAGGAGAAGTCAAGAAAGGGCCATGGTCGGCTGAAGAAGATAAATTACTTTTTAATTACGTTACAAATCATGACCAATTTCATTGGAGCTCCGTTCCCGAACAAAGTGGGTTGAAAAGATGTGGGAAGAGTTGCCGATTGAGATGGCTCAATTATTTGCACCCAGATCTTAAGCATGGAAATTTCAGTGCAGAAGAAATAGATCTTATATTTAGGGTTCAAAAGGATATCGG...

Protein

Download Protein FASTA

138 aa · TkA04G488710|TK1151|PROTEIN

MKGEHICCSKGEVKKGPWSAEEDKLLFNYVTNHDQFHWSSVPEQSGLKRCGKSCRLRWLNYLHPDLKHGNFSAEEIDLIFRVQKDIGNKWAEIARLLPGRTDNEIKNFWNSKMKKRPLSNKQCYCCKIRRIRINLEKY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G488710`
TK1151 ID	TkA04G488710
OH-1004 ID	LXL04_038966
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.855 / OH-1004 28.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G488710

Location Chr04:123573341-123575268 (-)

Description Similar to MYB86: Transcription factor MYB86

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At1g16490`	Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1.	MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis.2009 · DOI: 10.1105/tpc.108.063321
`At1g56160`	Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression.	Expression differences for genes involved in lignin, glutathione and sulphate metabolism in response to cadmium in Arabidopsis thaliana and the related Zn/Cd-hyperaccumulator Thlaspi caerulescens.2008 · DOI: 10.1111/j.1365-3040.2007.01764.x MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.2008 · DOI: 10.1104/pp.107.113829 MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe.2009 · DOI: 10.1111/j.1438-8677.2008.00162.x β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots.2014 · DOI: 10.1111/nph.12980
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009611 response to wounding Biological Process

GO:0009800 cinnamic acid biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009892 negative regulation of metabolic process Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G09540

ath:AT1G22640

ath:AT3G13890

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.869

Rank 1 · TkA04G488710 · TK1151

Cytoplasm0.194

Rank 2 · TkA04G488710 · TK1151

Mitochondrion0.036

Rank 3 · TkA04G488710 · TK1151

Cell membrane0.018

Rank 4 · TkA04G488710 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA04G488710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15963Myb_DNA-bind_714-30 aa

PF00249Myb_DNA-binding15-62 aa

PF13921Myb_DNA-bind_618-77 aa

PF00249Myb_DNA-binding69-111 aa

PF15963Myb_DNA-bind_770-119 aa

PF13921Myb_DNA-bind_671-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G488710	`PF15963`	Myb_DNA-bind_7	14	30	0.00041	20.8
TkA04G488710	`PF00249`	Myb_DNA-binding	15	62	3.3e-30	104.7
TkA04G488710	`PF13921`	Myb_DNA-bind_6	18	77	6.3e-19	68.6
TkA04G488710	`PF00249`	Myb_DNA-binding	69	111	3.3e-30	104.7
TkA04G488710	`PF15963`	Myb_DNA-bind_7	70	119	0.00041	20.8
TkA04G488710	`PF13921`	Myb_DNA-bind_6	71	114	6.3e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPH6`	Arabidopsis thaliana	sp\|Q8LPH6\|MYB86_ARATH Transcription factor MYB86	60.500%	Swiss-Prot	High
`Q8VZQ2`	Arabidopsis thaliana	sp\|Q8VZQ2\|MYB61_ARATH Transcription factor MYB61	59.600%	Swiss-Prot	High
`Q9SA47`	Arabidopsis thaliana	sp\|Q9SA47\|MYB58_ARATH Transcription factor MYB58	57.400%	Swiss-Prot	High
`Q9SGU3`	Arabidopsis thaliana	sp\|Q9SGU3\|MYB72_ARATH Transcription factor MYB72	56.500%	Swiss-Prot	High
`Q9S9K9`	Arabidopsis thaliana	sp\|Q9S9K9\|MYB3_ARATH Transcription factor MYB3	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card