TkA04G486710 | RubberDandelionOmics

Gene overview

TkA04G486710

Reference: TK1151 Chr: Chr04 Coordinates: 122986167-122988297 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

770 bp · TkA04G486710|TK1151|cDNA

AAAACCCTTCATCACCACTAAAGCCAACAACGTAAAACCCTTAACCACCGCTAAATCCACCACCTACCACCACCGTAATCACATATCAGAATTCGGAATGCAATTAATTCGTTCTGATAAATTATCCTGTCGACCTAGCCCTATATTCATTATATATACGAACTGAGGTACGTTTAAGCCCTCAATCTCTCTGTATATATACATACATTCTTTCATCTGGGGTTTGAGTTCGATTGAACCAGTCAAGAGACCGCAGATTT...

CDS

Download CDS FASTA

432 bp · TkA04G486710|TK1151|CDS

ATGCTCGCTCTGCGCCTAGGTCGCAGATTTAGAACTTACACCACCATTCCAGCCTCCACTACATCGACTTCTAAAACTAAAACTACTTTGAGCGCAAAGGATATCAAGAAACCCTCAACTTTAGAGGAACCCGCCCTTATTAAGCTCAAGGCAGAACGAGACCCCGAAAAATTATTTCATTTGTTCAAGGCTAATGCCCATAACCGCCTGGTTATAGAAAATCTGGTCGCATTTGAAGACACGATTTCCAGGCTAGCAGG...

Protein

Download Protein FASTA

143 aa · TkA04G486710|TK1151|PROTEIN

MLALRLGRRFRTYTTIPASTTSTSKTKTTLSAKDIKKPSTLEEPALIKLKAERDPEKLFHLFKANAHNRLVIENLVAFEDTISRLAGAGRFDYIEQLLEHQKALPQGRREGFIMRIISLYGKAGMVNHAINTFKVNIAMLDIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G486710`
TK1151 ID	TkA04G486710
OH-1004 ID	LXL04_038941
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 93.706 / OH-1004 31.829 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G486710

Location Chr04:122986167-122988297 (-)

Description Similar to At1g80150: Pentatricopeptide repeat-containing protein At1g80150, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80150`	Pentatricopeptide repeat-containing protein At1g80150, mitochondrial.	No verified direct reference in this release
`At3g13160`	Small ribosomal subunit protein mS79 (rPPR3b).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G55890

ath:AT1G61870

ath:AT1G80150

ath:AT3G13160

ath:AT4G36680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.922

Rank 1 · TkA04G486710 · TK1151

Nucleus0.046

Rank 2 · TkA04G486710 · TK1151

Cytoplasm0.041

Rank 3 · TkA04G486710 · TK1151

Plastid0.027

Rank 4 · TkA04G486710 · TK1151

Cell membrane0.012

Rank 5 · TkA04G486710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GW57`	Arabidopsis thaliana	sp\|Q8GW57\|PP134_ARATH Pentatricopeptide repeat-containing protein At1g80150, mitochondrial	79.600%	Swiss-Prot	Medium
`Q9LK57`	Arabidopsis thaliana	sp\|Q9LK57\|PP226_ARATH Small ribosomal subunit protein mS79 (rPPR3b)	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card