TkA04G483290 | RubberDandelionOmics

Gene overview

TkA04G483290

Reference: TK1151 Chr: Chr04 Coordinates: 122090979-122097882 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4020 bp · TkA04G483290|TK1151|cDNA

ATGAATACTCTCTCCCTCAATTTAAATGGCTTCGGCAAAGGCGATTTCAAAATCACTTGGGTGAATAGTTTGATTCAAAAACACAGGATTGCAATAGCATTTTTGCAAGAAACAAAGAGAAAGAACATAACGGATTTAAAGGTTAGTAAGATCTGGGGAAGCTTCGATTTCAACTATGATTGCAAAAACTCTATAGGGAAGGGAGGAGGTCTAGTGACTATCTGGAATAAAAATTTGTTCACAAAAACAGGAGATCAAAT...

CDS

Download CDS FASTA

4020 bp · TkA04G483290|TK1151|CDS

ATGAATACTCTCTCCCTCAATTTAAATGGCTTCGGCAAAGGCGATTTCAAAATCACTTGGGTGAATAGTTTGATTCAAAAACACAGGATTGCAATAGCATTTTTGCAAGAAACAAAGAGAAAGAACATAACGGATTTAAAGGTTAGTAAGATCTGGGGAAGCTTCGATTTCAACTATGATTGCAAAAACTCTATAGGGAAGGGAGGAGGTCTAGTGACTATCTGGAATAAAAATTTGTTCACAAAAACAGGAGATCAAAT...

Protein

Download Protein FASTA

1339 aa · TkA04G483290|TK1151|PROTEIN

MNTLSLNLNGFGKGDFKITWVNSLIQKHRIAIAFLQETKRKNITDLKVSKIWGSFDFNYDCKNSIGKGGGLVTIWNKNLFTKTGDQIRNDCIITYGIWSELNKPIAFINVYASQNPQIRADLWNFISRFIRSWDGLVITCGDFNDVRASVERRGSYFDKKASDKFNQFIHQNQLIECKSGGCHFTWNNGNGSKMSKLDRFLISSSVESAWPNHEVVADIKLHFDHVPLILKEIKRNYGITPFKMFNSWLEDDEFENLIIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G483290`
TK1151 ID	TkA04G483290
OH-1004 ID	LXL04_008933
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	38.100
Protein coverage (%)	TK1151 67.214 / OH-1004 45.493 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G483290

Location Chr04:122090979-122097882 (-)

Description Similar to RBK1: Receptor-like cytosolic serine/threonine-protein kinase RBK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q94HW2`	Retrovirus-related Pol polyprotein from transposon RE1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10620

ath:AT2G16750

ath:AT3G05140

ath:AT5G10520

ath:AT5G38560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.663

Rank 1 · TkA04G483290 · TK1151

Nucleus0.313

Rank 2 · TkA04G483290 · TK1151

Cell membrane0.070

Rank 3 · TkA04G483290 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA04G483290 · TK1151

Plastid0.043

Rank 5 · TkA04G483290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos4-208 aa

PF13966zf-RVT16-32 aa

PF14529Exo_endo_phos_2105-227 aa

PF14529Exo_endo_phos_2294-321 aa

PF10392COG5_N295-343 aa

PF14739DUF4472302-345 aa

PF00078RVT_1371-597 aa

PF00078RVT_1802-857 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G483290	`PF03372`	Exo_endo_phos	4	208	6.1e-10	39.9
TkA04G483290	`PF13966`	zf-RVT	16	32	1.1e-08	36.3
TkA04G483290	`PF14529`	Exo_endo_phos_2	105	227	0.00016	22.3
TkA04G483290	`PF14529`	Exo_endo_phos_2	294	321	0.00016	22.3
TkA04G483290	`PF10392`	COG5_N	295	343	0.27	12.2
TkA04G483290	`PF14739`	DUF4472	302	345	0.21	12.9
TkA04G483290	`PF00078`	RVT_1	371	597	2.4e-28	100.1
TkA04G483290	`PF00078`	RVT_1	802	857	2.4e-28	100.1
TkA04G483290	`PF13966`	zf-RVT	814	888	1.1e-08	36.3
TkA04G483290	`PF14739`	DUF4472	1024	1039	0.21	12.9
TkA04G483290	`PF13976`	gag_pre-integrs	1165	1225	2.6e-14	53.4
TkA04G483290	`PF00665`	rve	1242	1339	1.1e-10	42.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94HW2`	Arabidopsis thaliana	sp\|Q94HW2\|POLR1_ARATH Retrovirus-related Pol polyprotein from transposon RE1	34.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card