TkA04G480800 | RubberDandelionOmics

Gene overview

TkA04G480800

Reference: TK1151 Chr: Chr04 Coordinates: 121450015-121451163 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · TkA04G480800|TK1151|cDNA

TTCACACCCATTTTTCATATCTCTAGCTTAATTTCTCCCTTCCCTCTTTAAGCTATCAAAAATAAAGTTAACAGGTGAGAAGCTATTATTATTGCACTCATCGTTTCTCCAAATATTCAAGCTTTATCATGGCCACTACAGACTATATATCGGTGGTTGGTATGATCATTATGGTCATCTTCTTCTCGTCCTCTGTTTGGGCAGATCCTGATATGCTGCAAGATGTTTGTGTCGCAAATCTTGCCTCTGACATAACAATG...

CDS

Download CDS FASTA

660 bp · TkA04G480800|TK1151|CDS

ATGGCCACTACAGACTATATATCGGTGGTTGGTATGATCATTATGGTCATCTTCTTCTCGTCCTCTGTTTGGGCAGATCCTGATATGCTGCAAGATGTTTGTGTCGCAAATCTTGCCTCTGACATAACAATGAATGGATTTGCATGCAAACGCGAAGTCTCAGCCCATGATTTCTTCTTCGCTGGGCTAGCAAACCCAAGGTCCACCGACAACATATATAATGCGACAGTTACACAAGTCACTGTCCGAAATGTCACCGG...

Protein

Download Protein FASTA

219 aa · TkA04G480800|TK1151|PROTEIN

MATTDYISVVGMIIMVIFFSSSVWADPDMLQDVCVANLASDITMNGFACKREVSAHDFFFAGLANPRSTDNIYNATVTQVTVRNVTGLNTMGLSMSRIDFAPGGLNPPHFHPRASEIFIVIEGKLDVAFITTDYKLYSKSVKSGELFVFPRSLMHYQINNGKVPALALAVFNSQSPGIQRVATALFASSPSVPNHVLAKTFGIEIDEVKKIKSRLAPKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G480800`
TK1151 ID	TkA04G480800
OH-1004 ID	LXL04_039013
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G480800

Location Chr04:121450015-121451163 (+)

Description Similar to Os05g0277500: Germin-like protein 5-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62020`	May play a role in plant defense.	No verified direct reference in this release
`At1g09560`	May play a role in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0277500`	May play a role in plant defense.	No verified direct reference in this release
`Os01g0284500`	May play a role in plant defense.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039013 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004784 superoxide dismutase activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G09560

ath:AT3G62020

dosa:Os05g0277500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.741

Rank 1 · TkA04G480800 · TK1151

Lysosome / Vacuole0.085

Rank 2 · TkA04G480800 · TK1151

Endoplasmic reticulum0.068

Rank 3 · TkA04G480800 · TK1151

Cytoplasm0.059

Rank 4 · TkA04G480800 · TK1151

Cell membrane0.050

Rank 5 · TkA04G480800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190Cupin_162-208 aa

PF12973Cupin_789-127 aa

PF07883Cupin_298-171 aa

PF19480DUF6016100-133 aa

PF14667Polysacc_synt_C101-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G480800	`PF00190`	Cupin_1	62	208	3e-44	150.9
TkA04G480800	`PF12973`	Cupin_7	89	127	0.05	14.1
TkA04G480800	`PF07883`	Cupin_2	98	171	3.5e-11	43.4
TkA04G480800	`PF19480`	DUF6016	100	133	0.0035	17.6
TkA04G480800	`PF14667`	Polysacc_synt_C	101	134	0.21	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M263`	Arabidopsis thaliana	sp\|Q9M263\|GL24_ARATH Germin-like protein subfamily 2 member 4	55.600%	Swiss-Prot	High
`P94014`	Arabidopsis thaliana	sp\|P94014\|GL21_ARATH Germin-like protein subfamily 2 member 1	55.200%	Swiss-Prot	High
`Q6I544`	Oryza sativa subsp. japonica	sp\|Q6I544\|GL52_ORYSJ Germin-like protein 5-1	54.500%	Swiss-Prot	High
`Q7F731`	Oryza sativa subsp. japonica	sp\|Q7F731\|GL11_ORYSJ Germin-like protein 1-1	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card