TkA04G478500 | RubberDandelionOmics

Gene overview

TkA04G478500

Reference: TK1151 Chr: Chr04 Coordinates: 120902980-120906518 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2771 bp · TkA04G478500|TK1151|cDNA

AAAATAATGAGACTTTTGATATTAATCGTTATATGAAGTTAGACTTTATTTATAAACGACTATCCATCCGACGAAGATCTGTTCATCCGTATCCATTGAGACTGAGAACAGAAGCTCGGCAAAATCCCCCCTCGATTCGCATTTAGCCGTGAGAAACAAATACTCTTCTTTATTCTTTCCTTTCACCAATAAAAATCTAACAACGCCTCGCATCGCCGAAGCTCGGCAAAATCCCTCTAGGGTTCTATATACGGTGGTTG...

CDS

Download CDS FASTA

2061 bp · TkA04G478500|TK1151|CDS

ATGGGTAGTGTTTGGCAGGAAGGAAATGTCGGTAATGTAAACAACAGAGGAGCTGGGTATTCGATAGGTGCAACTCCTGGTCATGGATTTGAAGTAGGGGATATGGTTTGGGGAAAAGTGAAATCTCACCCGTGGTGGCCTGGCCATGTGTACAGTGAAGAGCTTACAACCCCTTCAGTTCGTCGATCAAAGAGAGATGATCTATTGTTGGTTGCCTTCTTCGGTGACAGTAGTTATGGGTGGTTTGATCCTTCAGAACT...

Protein

Download Protein FASTA

686 aa · TkA04G478500|TK1151|PROTEIN

MGSVWQEGNVGNVNNRGAGYSIGATPGHGFEVGDMVWGKVKSHPWWPGHVYSEELTTPSVRRSKRDDLLLVAFFGDSSYGWFDPSELIPFDSNFSDKSLRTNSRTFVKALEEAIDEVRRRTALGLSCMCRNKQNFRQTDAHGFFAVDVAGYEPGAVYSIDTTVKARESFQTRLTLDFVRELALEPTDEHDDIDFIKNKATVMSYRRTVFEEIDETYDQAFSGDLVRPLSGSVQVSSPRKKPSKAPLSGRQVFDAKHNKPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G478500`
TK1151 ID	TkA04G478500
OH-1004 ID	LXL04_038936
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G478500

Location Chr04:120902980-120906518 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27650`	Together with PDP2, PDP3 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	No verified direct reference in this release
`At3g05430`	May influence gene expression by regulating the function of the PRC2 complex and modulating H3K27me3 level.	No verified direct reference in this release
`At5g40340`	Together with PDP1, PDP2 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	Arabidopsis PWWP domain proteins mediate H3K27 trimethylation on FLC and regulate flowering time.2018 · DOI: 10.1111/jipb.12630
`At3g09670`	Together with PDP1, PDP3 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038936 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0035098 ESC/E(Z) complex Cellular Component

KEGG gene cross-reference

ath:AT3G05430

ath:AT5G02950

ath:AT5G27650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977

Rank 1 · TkA04G478500 · TK1151

Cytoplasm0.059

Rank 2 · TkA04G478500 · TK1151

Cell membrane0.023

Rank 3 · TkA04G478500 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA04G478500 · TK1151

Plastid0.010

Rank 5 · TkA04G478500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20884MUM1-like_PWWP30-51 aa

PF00855PWWP33-117 aa

PF00855PWWP462-470 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G478500	`PF20884`	MUM1-like_PWWP	30	51	0.034	15.5
TkA04G478500	`PF00855`	PWWP	33	117	4e-20	72.8
TkA04G478500	`PF00855`	PWWP	462	470	4e-20	72.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K4D6`	Arabidopsis thaliana	sp\|F4K4D6\|PDP1_ARATH PWWP domain-containing protein 1	52.700%	Swiss-Prot	Low
`Q9MA56`	Arabidopsis thaliana	sp\|Q9MA56\|PDP4_ARATH PWWP domain-containing protein 4	49.800%	Swiss-Prot	Low
`Q9FNE4`	Arabidopsis thaliana	sp\|Q9FNE4\|PDP3_ARATH PWWP domain-containing protein 3	42.500%	Swiss-Prot	Low
`Q9SF36`	Arabidopsis thaliana	sp\|Q9SF36\|PDP2_ARATH PWWP domain-containing protein 2	26.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card