TkA04G472690 | RubberDandelionOmics

Gene overview

TkA04G472690

Reference: TK1151 Chr: Chr04 Coordinates: 119375381-119378452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · TkA04G472690|TK1151|cDNA

GGATGATTTCGTGGCCCAAAGTGAATATTTTCCTTCTTTTTTCCCCCAAATATCCCGAGCAAATTACTTCTTCCTCTGTCTCAAGAACTTGAGATCAGTTTAAGTTCTCCATCGCAAAAAGATTTATGGTGATTGAGGGTGTAAGCAAATTGCTGTTACGGTTTTGTCATAAATAATAACTACGGTTCTCCTGGATTCTCCCTCTCCCAAATCTTTCCATCGTTCCTGAGATTATTACTGGAAGAGAAGGAATCCATGGA...

CDS

Download CDS FASTA

468 bp · TkA04G472690|TK1151|CDS

ATGGACGGATCTTGCTATTACTCTGTTCTCGGTATCCGTAAGGATGCTTCATCCTCTGAGATTCGATCTGCATATCGCAAGCTCGCTCTGGAATGGCATCCGGACAAGTGGGCCAAAAACCCTTCCCTCGCCGGAGACGCTAACCGAAAGTTCCAGAAGATCCAGGAGGCTTATTCAGTGTTATCGGATCGAACGAAAAAGTCCGCCTACGACGCCGGTACCGTTGATTTACTCGACGACATTGATGACAAAGAAGGAAT...

Protein

Download Protein FASTA

155 aa · TkA04G472690|TK1151|PROTEIN

MDGSCYYSVLGIRKDASSSEIRSAYRKLALEWHPDKWAKNPSLAGDANRKFQKIQEAYSVLSDRTKKSAYDAGTVDLLDDIDDKEGMGDFLHDLMKMMDQNAGAEVESLEDLQKTFVEMFGDDLREFMEKEDQTARKRARVSVEKANMPRSSACR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G472690`
TK1151 ID	TkA04G472690
OH-1004 ID	LXL04_009058
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.000
Protein coverage (%)	TK1151 78.710 / OH-1004 60.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G472690`
Location	Chr04:119375381-119378452 (+)
Description	Similar to dnaJ: Chaperone protein DnaJ (Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009058` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0030544 Hsp70 protein binding Molecular Function GO:0031072 heat shock protein binding Molecular Function GO:0044183 protein folding chaperone Molecular Function
KEGG gene cross-reference	bid:Bind_0129 bta:282215 gga:420448 pon:100174558 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.574

Rank 1 · TkA04G472690 · TK1151

Nucleus0.518

Rank 2 · TkA04G472690 · TK1151

Mitochondrion0.059

Rank 3 · TkA04G472690 · TK1151

Peroxisome0.052

Rank 4 · TkA04G472690 · TK1151

Endoplasmic reticulum0.050

Rank 5 · TkA04G472690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ6-71 aa

PF30912TIM141_C9-68 aa

PF06748DUF121715-65 aa

PF30945NFKBIL1_C15-38 aa

PF16767KinB_sensor46-74 aa

PF06748DUF121788-120 aa

PF16767KinB_sensor93-140 aa

PF30912TIM141_C137-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G472690	`PF00226`	DnaJ	6	71	4.2e-25	88.3
TkA04G472690	`PF30912`	TIM141_C	9	68	0.0002	22.0
TkA04G472690	`PF06748`	DUF1217	15	65	0.071	14.0
TkA04G472690	`PF30945`	NFKBIL1_C	15	38	0.085	13.4
TkA04G472690	`PF16767`	KinB_sensor	46	74	0.23	12.7
TkA04G472690	`PF06748`	DUF1217	88	120	0.071	14.0
TkA04G472690	`PF16767`	KinB_sensor	93	140	0.23	12.7
TkA04G472690	`PF30912`	TIM141_C	137	149	0.0002	22.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card