TkA04G471610 | RubberDandelionOmics

Gene overview

TkA04G471610

Reference: TK1151 Chr: Chr04 Coordinates: 119103173-119103517 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA04G471610|TK1151|cDNA

ATGGTTAATGCGTGGGCCCTCGCAAGGGATCCTGAGTATTGGCATGATGCTGAAAGTTTTGTACCGGAGAGATTTGAAGACATGAGTTGTTATGATTTCAAGGGAAGCAACATGGAGCATTTACCTTTTGGGGCTGGAAGGAGAATATGTCCAGGGATTTTGTTTGGTGTGGCTAATGTTGAGTTTGTTCTTGCAAGTTTACTTTATAGCTTTGACTGGGAGCTCCCTAATGGGATGAAAGTTGCGGATTTGGATATGAT...

CDS

Download CDS FASTA

345 bp · TkA04G471610|TK1151|CDS

ATGGTTAATGCGTGGGCCCTCGCAAGGGATCCTGAGTATTGGCATGATGCTGAAAGTTTTGTACCGGAGAGATTTGAAGACATGAGTTGTTATGATTTCAAGGGAAGCAACATGGAGCATTTACCTTTTGGGGCTGGAAGGAGAATATGTCCAGGGATTTTGTTTGGTGTGGCTAATGTTGAGTTTGTTCTTGCAAGTTTACTTTATAGCTTTGACTGGGAGCTCCCTAATGGGATGAAAGTTGCGGATTTGGATATGAT...

Protein

Download Protein FASTA

114 aa · TkA04G471610|TK1151|PROTEIN

MVNAWALARDPEYWHDAESFVPERFEDMSCYDFKGSNMEHLPFGAGRRICPGILFGVANVEFVLASLLYSFDWELPNGMKVADLDMMETFGASIRRKTSLQLIATPYDLNSGDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G471610`
TK1151 ID	TkA04G471610
OH-1004 ID	LXL04_038850
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 56.436 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G471610

Location Chr04:119103173-119103517 (-)

Description Similar to CYP71D55: Premnaspirodiene oxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0178400`	Involved in momilactone phytoalexins biosynthesis; acts as a multifunctional diterpene oxidase.	Identification of a biosynthetic gene cluster in rice for momilactones.2007 · DOI: 10.1074/jbc.m703344200 CYP99A3: functional identification of a diterpene oxidase from the momilactone biosynthetic gene cluster in rice.2011 · DOI: 10.1111/j.1365-313x.2010.04408.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038850 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0102170 5-epi-aristolochene-1,3-dihydroxylase activity Molecular Function

KEGG gene cross-reference

ag:AAK62342

ag:ABS00393

nta:107759261

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.318

Rank 1 · TkA04G471610 · TK1151

Endoplasmic reticulum0.221

Rank 2 · TkA04G471610 · TK1151

Peroxisome0.150

Rank 3 · TkA04G471610 · TK1151

Nucleus0.085

Rank 4 · TkA04G471610 · TK1151

Plastid0.058

Rank 5 · TkA04G471610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4501-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G471610	`PF00067`	p450	1	88	3.3e-22	79.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0JF01`	Oryza sativa subsp. japonica	sp\|Q0JF01\|C99A3_ORYSJ 9-beta-pimara-7,15-diene oxidase	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card