Gene Card
Gene overview
cDNA / CDS / Protein Sequences
345 bp · TkA04G465160|TK1151|cDNA
ATGTGGCTTCAAGTTGTTCACATTCTGTCCAATACACAGAGCTTGAACACCAAGTTCTTCTCTTTACAGGTTACTATCTTTATCTTCGAAGGAATGAAAAACTATATATCTGATGTTATTGTCAAGCTTTCAAGTAATGAGAGTTCTTTCCGCCAAGAAAGATTGTATGTTAACAAACTTAACATTATACTGGTTCAGATATTGAAAGATGAGTGGCCAGCCAGGTTGCGAAGCTTCATTCCCGACCTAGTTGCAGCAGC...
345 bp · TkA04G465160|TK1151|CDS
ATGTGGCTTCAAGTTGTTCACATTCTGTCCAATACACAGAGCTTGAACACCAAGTTCTTCTCTTTACAGGTTACTATCTTTATCTTCGAAGGAATGAAAAACTATATATCTGATGTTATTGTCAAGCTTTCAAGTAATGAGAGTTCTTTCCGCCAAGAAAGATTGTATGTTAACAAACTTAACATTATACTGGTTCAGATATTGAAAGATGAGTGGCCAGCCAGGTTGCGAAGCTTCATTCCCGACCTAGTTGCAGCAGC...
Protein
Download Protein FASTA114 aa · TkA04G465160|TK1151|PROTEIN
MWLQVVHILSNTQSLNTKFFSLQVTIFIFEGMKNYISDVIVKLSSNESSFRQERLYVNKLNIILVQILKDEWPARLRSFIPDLVAAAKTSETICENCMAISNFHILFFLISCFF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G465160 |
|---|---|
| TK1151 ID | TkA04G465160 |
| OH-1004 ID | LXL04_026616 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 90.000 |
| Protein coverage (%) | TK1151 87.719 / OH-1004 29.940Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G465160 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:117438510-117439170 (-) | |||||||||
| Description | Similar to XPO1: Protein EXPORTIN 1A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000054 ribosomal subunit export from nucleus Biological Process GO:0000055 ribosomal large subunit export from nucleus Biological Process GO:0000056 ribosomal small subunit export from nucleus Biological Process GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0006611 protein export from nucleus Biological Process GO:0006913 nucleocytoplasmic transport Biological Process GO:0009408 response to heat Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0009846 pollen germination Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G03110 ath:AT5G17020 hsa:7514 mmu:103573 rno:85252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08389Xpo117-48 aaPF10796Anti-adapt_IraP32-89 aaPF08389Xpo154-100 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G465160 | PF08389 | Xpo1 | 17 | 48 | 5.3e-10 | 40.3 |
| TkA04G465160 | PF10796 | Anti-adapt_IraP | 32 | 89 | 0.16 | 13.4 |
| TkA04G465160 | PF08389 | Xpo1 | 54 | 100 | 5.3e-10 | 40.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.