Gene Card
Gene overview
cDNA / CDS / Protein Sequences
345 bp · TkA04G462190|TK1151|cDNA
ATGGGTAGCGTTGAAAATGGTGGAATCTTGATGGGTAGTGATCAAGATCAAGAAATCATGAACCCGATGTTCCATAATCAACAACATCTGATCAACAACAGTGGAGCAACAACACCGGCGACAATGGCGGCAATGAAACAAGAAACATGCCATGAGTTAGGAGAGAATAATAGAGGGTCGGGAGGGATATTGTGGGGAATTCCATGGCAGATGGGTGCAGGTGGAGGTGGAGATCAAGGGATGAATGCGATCCATGAAGT...
345 bp · TkA04G462190|TK1151|CDS
ATGGGTAGCGTTGAAAATGGTGGAATCTTGATGGGTAGTGATCAAGATCAAGAAATCATGAACCCGATGTTCCATAATCAACAACATCTGATCAACAACAGTGGAGCAACAACACCGGCGACAATGGCGGCAATGAAACAAGAAACATGCCATGAGTTAGGAGAGAATAATAGAGGGTCGGGAGGGATATTGTGGGGAATTCCATGGCAGATGGGTGCAGGTGGAGGTGGAGATCAAGGGATGAATGCGATCCATGAAGT...
Protein
Download Protein FASTA114 aa · TkA04G462190|TK1151|PROTEIN
MGSVENGGILMGSDQDQEIMNPMFHNQQHLINNSGATTPATMAAMKQETCHELGENNRGSGGILWGIPWQMGAGGGGDQGMNAIHEVESGRSQIAGWNGLGSTAWHGLINSPLM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G462190 |
|---|---|
| TK1151 ID | TkA04G462190 |
| OH-1004 ID | LXL04_021076 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 32.022Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G462190 |
|---|---|
| Location | Chr04:116625423-116625767 (-) |
| Description | Similar to DOF2.1: Dof zinc finger protein DOF2.1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0048364 root development Biological Process GO:0090057 root radial pattern formation Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0008270 zinc ion binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G51700 ath:AT2G28510 ath:AT3G45610 ath:AT5G60200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.