TkA04G460820 | RubberDandelionOmics

Gene overview

TkA04G460820

Reference: TK1151 Chr: Chr04 Coordinates: 116210324-116211141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

412 bp · TkA04G460820|TK1151|cDNA

GTGATCCAGTTTTGACCGCCTTTGTATTCTGCAAGCTGTGGAGGGACAGGTTTTGGGTAAGAGCAAGATGATATTAAGGCTTCTGGAGGGACTTCCAACAATGCTGAAGGGTAAGTTTTTGTTAAAAATGAAACCTGAATTGCACTATGGGGAGGATGACTGTCCAGTCTCTGCTTCAGATAGCTTTCCAAAGGACGCTAAACTTAATTTTGAGATTGAGCTTATAGGTTTTTCTAAAGTCAAGATTGTTACAGAAGATT...

CDS

Download CDS FASTA

312 bp · TkA04G460820|TK1151|CDS

ATGATATTAAGGCTTCTGGAGGGACTTCCAACAATGCTGAAGGGTAAGTTTTTGTTAAAAATGAAACCTGAATTGCACTATGGGGAGGATGACTGTCCAGTCTCTGCTTCAGATAGCTTTCCAAAGGACGCTAAACTTAATTTTGAGATTGAGCTTATAGGTTTTTCTAAAGTCAAGATTGTTACAGAAGATTTTGGAGTATTAAAGAAGGCTGTACACGAGGCACAAAGTTGGGAGAACCCAAGGGATATCTATGAAGA...

Protein

Download Protein FASTA

103 aa · TkA04G460820|TK1151|PROTEIN

MILRLLEGLPTMLKGKFLLKMKPELHYGEDDCPVSASDSFPKDAKLNFEIELIGFSKVKIVTEDFGVLKKAVHEAQSWENPRDIYEDFCQIRKWTTTSITQEQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G460820`
TK1151 ID	TkA04G460820
OH-1004 ID	LXL04_037225
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 83.495 / OH-1004 32.950 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G460820

Location Chr04:116210324-116211141 (+)

Description Similar to PAS1: Peptidyl-prolyl cis-trans isomerase PASTICCINO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54010`	PPIases accelerate the folding of proteins.	Very-long-chain fatty acids are involved in polar auxin transport and developmental patterning in Arabidopsis.2010 · DOI: 10.1105/tpc.109.071209 The PASTICCINO genes of Arabidopsis thaliana are involved in the control of cell division and differentiation.1998 · DOI: 10.1242/dev.125.5.909 Mutation in the Arabidopsis PASTICCINO1 gene, which encodes a new FK506-binding protein-like protein, has a dramatic effect on plant development.1998 · DOI: 10.1128/mcb.18.5.3034

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037225 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009611 response to wounding Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009845 seed germination Biological Process

GO:0009880 embryonic pattern specification Biological Process

KEGG gene cross-reference

ath:AT3G25230

ath:AT3G54010

ath:AT5G48570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.462

Rank 1 · TkA04G460820 · TK1151

Cytoplasm0.454

Rank 2 · TkA04G460820 · TK1151

Extracellular0.103

Rank 3 · TkA04G460820 · TK1151

Mitochondrion0.081

Rank 4 · TkA04G460820 · TK1151

Cell membrane0.047

Rank 5 · TkA04G460820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00254FKBP_C5-53 aa

PF23482YLR146W-A86-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G460820	`PF00254`	FKBP_C	5	53	0.00021	22.3
TkA04G460820	`PF23482`	YLR146W-A	86	100	0.21	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7DMA9`	Arabidopsis thaliana	sp\|Q7DMA9\|PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1	58.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card