TkA04G454250 | RubberDandelionOmics

Gene overview

TkA04G454250

Reference: TK1151 Chr: Chr04 Coordinates: 114508559-114508990 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA04G454250|TK1151|cDNA

ATGAGGAAGGGAAAGAAGATCGAGAAACTCATGCCAATGAAGAAATTCACGAACATTAGTTGGAAGCTACTGTCTATAGAACTAAAACAAGAAACGAGGGCCCCGGGTAGTGACGATCACTACCCCTATGATGAGTTGAAAATAAAACTCATGAGAATGAATTTCGCATTCCATAACGATCAATTGCCACAAAACCTTATGATCTTCTGTCGCGGTTTGTTTGCTGATGATTCTAAGGTTACACAAGAAGACATTGATAA...

CDS

Download CDS FASTA

432 bp · TkA04G454250|TK1151|CDS

ATGAGGAAGGGAAAGAAGATCGAGAAACTCATGCCAATGAAGAAATTCACGAACATTAGTTGGAAGCTACTGTCTATAGAACTAAAACAAGAAACGAGGGCCCCGGGTAGTGACGATCACTACCCCTATGATGAGTTGAAAATAAAACTCATGAGAATGAATTTCGCATTCCATAACGATCAATTGCCACAAAACCTTATGATCTTCTGTCGCGGTTTGTTTGCTGATGATTCTAAGGTTACACAAGAAGACATTGATAA...

Protein

Download Protein FASTA

143 aa · TkA04G454250|TK1151|PROTEIN

MRKGKKIEKLMPMKKFTNISWKLLSIELKQETRAPGSDDHYPYDELKIKLMRMNFAFHNDQLPQNLMIFCRGLFADDSKVTQEDIDKIVEEVKERKKREQEAADDGDDDDAEEKAAKEKADEDDDGEDDAEEKSVKDEDEDDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G454250`
TK1151 ID	TkA04G454250
OH-1004 ID	LXL04_037677
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.700
Protein coverage (%)	TK1151 41.259 / OH-1004 17.933 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G454250`
Location	Chr04:114508559-114508990 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037677` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.548

Rank 1 · TkA04G454250 · TK1151

Cytoplasm0.360

Rank 2 · TkA04G454250 · TK1151

Extracellular0.118

Rank 3 · TkA04G454250 · TK1151

Cell membrane0.071

Rank 4 · TkA04G454250 · TK1151

Mitochondrion0.056

Rank 5 · TkA04G454250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09184PPP4R222-142 aa

PF05997Nop5251-129 aa

PF31011UBR7_C62-98 aa

PF12226Astro_capsid_p72-143 aa

PF02724CDC4576-141 aa

PF08432Vfa178-137 aa

PF24181TPR_TTI1_C79-133 aa

PF11705RNA_pol_3_Rpc3180-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G454250	`PF09184`	PPP4R2	22	142	0.05	13.9
TkA04G454250	`PF05997`	Nop52	51	129	0.19	12.0
TkA04G454250	`PF31011`	UBR7_C	62	98	0.0072	17.3
TkA04G454250	`PF12226`	Astro_capsid_p	72	143	3.0	7.6
TkA04G454250	`PF02724`	CDC45	76	141	3.6	6.5
TkA04G454250	`PF08432`	Vfa1	78	137	1.7	9.7
TkA04G454250	`PF24181`	TPR_TTI1_C	79	133	0.75	10.1
TkA04G454250	`PF11705`	RNA_pol_3_Rpc31	80	143	2.0	9.1
TkA04G454250	`PF04147`	Nop14	84	141	2.9	6.7
TkA04G454250	`PF11702`	DUF3295	86	134	6.2	6.8
TkA04G454250	`PF31011`	UBR7_C	130	139	0.0072	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card