TkA04G453560 | RubberDandelionOmics

Gene overview

TkA04G453560

Reference: TK1151 Chr: Chr04 Coordinates: 114318449-114318955 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · TkA04G453560|TK1151|cDNA

ATGCGTGTGTTGATTATTCTTGTATATTTAATGTGTAGGGATGAACTACAGTTAATAAAAGACATTGTCAACAAAGTTTCAAAGATGATACGCCCATTAACTCCAAGGGTGAAAGACAATCTTGTTGGCATAGAGGCTCGCATGGACGCTCTGATATCAAAGATGCAGAATGGATCAGAATGTGTGCTCATGATTGGAATATGGGGTGTTGGGGGTGGTGGTAAGACTACTCTTGCAAATTCTGTTTACAGTAAAATCTA...

CDS

Download CDS FASTA

507 bp · TkA04G453560|TK1151|CDS

ATGCGTGTGTTGATTATTCTTGTATATTTAATGTGTAGGGATGAACTACAGTTAATAAAAGACATTGTCAACAAAGTTTCAAAGATGATACGCCCATTAACTCCAAGGGTGAAAGACAATCTTGTTGGCATAGAGGCTCGCATGGACGCTCTGATATCAAAGATGCAGAATGGATCAGAATGTGTGCTCATGATTGGAATATGGGGTGTTGGGGGTGGTGGTAAGACTACTCTTGCAAATTCTGTTTACAGTAAAATCTA...

Protein

Download Protein FASTA

168 aa · TkA04G453560|TK1151|PROTEIN

MRVLIILVYLMCRDELQLIKDIVNKVSKMIRPLTPRVKDNLVGIEARMDALISKMQNGSECVLMIGIWGVGGGGKTTLANSVYSKIYSEYDGCCFIENIRDESLKNGVAGSFNWFAKGSRIIITTRNVHLLKAHEVVVHGISLLNNDEATKLLRKWVNNLINRCKQSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G453560`
TK1151 ID	TkA04G453560
OH-1004 ID	LXL04_038650
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.400
Protein coverage (%)	TK1151 98.810 / OH-1004 86.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G453560`
Location	Chr04:114318449-114318955 (+)
Description	Similar to L6: Disease resistance protein L6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038650` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002239 response to oomycetes Biological Process GO:0002758 innate immune response-activating signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0019677 NAD+ catabolic process Biological Process GO:0034052 positive regulation of plant-type hypersensitive response Biological Process GO:0042742 defense response to bacterium Biological Process GO:0043068 positive regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ag:AAA91022 ath:AT3G44480 ath:AT4G12010 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.268

Rank 1 · TkA04G453560 · TK1151

Extracellular0.221

Rank 2 · TkA04G453560 · TK1151

Cell membrane0.189

Rank 3 · TkA04G453560 · TK1151

Cytoplasm0.180

Rank 4 · TkA04G453560 · TK1151

Lysosome / Vacuole0.114

Rank 5 · TkA04G453560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26561LETM1_C23-31 aa

PF00931NB-ARC45-96 aa

PF26561LETM1_C47-57 aa

PF13238AAA_1865-115 aa

PF05729NACHT67-90 aa

PF20720nSTAND367-101 aa

PF00931NB-ARC112-158 aa

PF05729NACHT117-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G453560	`PF26561`	LETM1_C	23	31	0.18	12.7
TkA04G453560	`PF00931`	NB-ARC	45	96	5.1e-12	46.4
TkA04G453560	`PF26561`	LETM1_C	47	57	0.18	12.7
TkA04G453560	`PF13238`	AAA_18	65	115	0.17	13.1
TkA04G453560	`PF05729`	NACHT	67	90	0.028	15.0
TkA04G453560	`PF20720`	nSTAND3	67	101	0.058	13.8
TkA04G453560	`PF00931`	NB-ARC	112	158	5.1e-12	46.4
TkA04G453560	`PF05729`	NACHT	117	158	0.028	15.0
TkA04G453560	`PF20720`	nSTAND3	119	135	0.058	13.8
TkA04G453560	`PF26561`	LETM1_C	143	163	0.18	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card