TkA04G450960 | RubberDandelionOmics

Gene overview

TkA04G450960

Reference: TK1151 Chr: Chr04 Coordinates: 113607557-113608721 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

888 bp · TkA04G450960|TK1151|cDNA

ATGTCTGTTACTTCTCCTCCTCTTCTGCAGTTCCCCTCTCGCTGTAATCAGTGCCCTAAAAAGCGCCGGAAGGATTATAAACGCAGAAGCCATGGACAACGCTCAAGTATGGCTAACATGGCTCCAAAGCTCAAGCTGGTTAGCAACAATAATCTTCCAATTTCTCCCAAACGTTCTTATATTCATGGAGAAGACTGTAAACGAATAGAACAATACATGTCAGCTTCCTTTCTATCACGATCATGTCTCTCATCTGTTGC...

CDS

Download CDS FASTA

888 bp · TkA04G450960|TK1151|CDS

ATGTCTGTTACTTCTCCTCCTCTTCTGCAGTTCCCCTCTCGCTGTAATCAGTGCCCTAAAAAGCGCCGGAAGGATTATAAACGCAGAAGCCATGGACAACGCTCAAGTATGGCTAACATGGCTCCAAAGCTCAAGCTGGTTAGCAACAATAATCTTCCAATTTCTCCCAAACGTTCTTATATTCATGGAGAAGACTGTAAACGAATAGAACAATACATGTCAGCTTCCTTTCTATCACGATCATGTCTCTCATCTGTTGC...

Protein

Download Protein FASTA

295 aa · TkA04G450960|TK1151|PROTEIN

MSVTSPPLLQFPSRCNQCPKKRRKDYKRRSHGQRSSMANMAPKLKLVSNNNLPISPKRSYIHGEDCKRIEQYMSASFLSRSCLSSVAFLITSTFLGISFDLLAPIPWIKKKLQKFRKNDMLQLVPEQNDEYALEENQGLERPLVIPPDVDNYNLNEYPISRTSPVPKQAFDFAQYYAFNLTIFALTLIYSSFSPLIVPVGAIYFGYRYVVDKYNFLFVYRVRGFPAGNDGRGDATKLQAILTFGVLVVHKIWPNESEGFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G450960`
TK1151 ID	TkA04G450960
OH-1004 ID	LXL04_013832
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.700
Protein coverage (%)	TK1151 80.678 / OH-1004 32.878 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G450960

Location Chr04:113607557-113608721 (-)

Description Similar to GFS10: CSC1-like protein At4g35870

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35870`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013832 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001817 regulation of cytokine production Biological Process

GO:0003094 glomerular filtration Biological Process

GO:0006623 protein targeting to vacuole Biological Process

GO:0007040 lysosome organization Biological Process

GO:0036335 intestinal stem cell homeostasis Biological Process

GO:0045428 regulation of nitric oxide biosynthetic process Biological Process

GO:0050764 regulation of phagocytosis Biological Process

GO:0160069 surfactant secretion Biological Process

GO:0005765 lysosomal membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G35870

mmu:208795

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.295

Rank 1 · TkA04G450960 · TK1151

Cell membrane0.251

Rank 2 · TkA04G450960 · TK1151

Cytoplasm0.181

Rank 3 · TkA04G450960 · TK1151

Nucleus0.172

Rank 4 · TkA04G450960 · TK1151

Lysosome / Vacuole0.148

Rank 5 · TkA04G450960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02714RSN1_7TM86-114 aa

PF02714RSN1_7TM168-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G450960	`PF02714`	RSN1_7TM	86	114	2.9e-12	47.3
TkA04G450960	`PF02714`	RSN1_7TM	168	220	2.9e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZT4`	Arabidopsis thaliana	sp\|Q9SZT4\|OSC41_ARATH Hyperosmolality-gated Ca2+ permeable channel 4.1	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card