TkA04G450310 | RubberDandelionOmics

Gene overview

TkA04G450310

Reference: TK1151 Chr: Chr04 Coordinates: 113416066-113418448 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

557 bp · TkA04G450310|TK1151|cDNA

TTTCGGAATTTTTTAAGCACCTATATTTCGAATTCAATTTTTGAAGCATCTTGAAGATGAAGAACAACCGAAGCGGAGGGGGAAAAGTATCACCTAAATGGATTATAATTTTCAGCATCTTCAGTTTCGTACTTGGCATGCTTTTTACAAACAGGGTGTGGGCTCCAATAGAATCCGATGGAAGGATCATGAGGCGGAAAGAACAAGAGATGAAAATCGTCACCGATGATTATATAACAAACAAGGATAATGATTTAATG...

CDS

Download CDS FASTA

510 bp · TkA04G450310|TK1151|CDS

ATGAAGAACAACCGAAGCGGAGGGGGAAAAGTATCACCTAAATGGATTATAATTTTCAGCATCTTCAGTTTCGTACTTGGCATGCTTTTTACAAACAGGGTGTGGGCTCCAATAGAATCCGATGGAAGGATCATGAGGCGGAAAGAACAAGAGATGAAAATCGTCACCGATGATTATATAACAAACAAGGATAATGATTTAATGGGCGAAGTTCATAAAACCCAAGAAGCAATTCAGTCTATCAGGTCACTTGAAAACTC...

Protein

Download Protein FASTA

169 aa · TkA04G450310|TK1151|PROTEIN

MKNNRSGGGKVSPKWIIIFSIFSFVLGMLFTNRVWAPIESDGRIMRRKEQEMKIVTDDYITNKDNDLMGEVHKTQEAIQSIRSLENSISELRLELPHNQSSFEEVKDDNLHSYKTNEDKSGRRTKAFMVIGINTAFSSRRRRDSIRETWMPRGNSVHTLLHTIFSVLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G450310`
TK1151 ID	TkA04G450310
OH-1004 ID	LXL04_011265
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.200
Protein coverage (%)	TK1151 92.308 / OH-1004 90.173 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G450310

Location Chr04:113416066-113418448 (+)

Description Similar to B3GALT7: Beta-1,3-galactosyltransferase 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22015`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g77810`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	Identification of a novel group of putative Arabidopsis thaliana beta-(1,3)-galactosyltransferases.2008 · DOI: 10.1007/s11103-008-9351-3
`At1g33430`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At1g05170`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release
`At4g26940`	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010407 non-classical arabinogalactan protein metabolic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0008378 galactosyltransferase activity Molecular Function

GO:0048531 beta-1,3-galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05170

ath:AT1G22015

ath:AT1G32930

ath:AT1G33430

ath:AT1G77810

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.737

Rank 1 · TkA04G450310 · TK1151

Endoplasmic reticulum0.120

Rank 2 · TkA04G450310 · TK1151

Cytoplasm0.077

Rank 3 · TkA04G450310 · TK1151

Cell membrane0.072

Rank 4 · TkA04G450310 · TK1151

Extracellular0.058

Rank 5 · TkA04G450310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334DUF409412-100 aa

PF01762Galactosyl_T58-79 aa

PF15770DUF4699103-150 aa

PF30355zf_C2H2-Disco109-111 aa

PF30355zf_C2H2-Disco129-144 aa

PF01762Galactosyl_T140-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G450310	`PF13334`	DUF4094	12	100	6.9e-22	78.4
TkA04G450310	`PF01762`	Galactosyl_T	58	79	0.069	13.6
TkA04G450310	`PF15770`	DUF4699	103	150	0.038	14.0
TkA04G450310	`PF30355`	zf_C2H2-Disco	109	111	0.014	16.1
TkA04G450310	`PF30355`	zf_C2H2-Disco	129	144	0.014	16.1
TkA04G450310	`PF01762`	Galactosyl_T	140	164	0.069	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM60`	Arabidopsis thaliana	sp\|Q9LM60\|B3GT5_ARATH Probable beta-1,3-galactosyltransferase 5	46.300%	Swiss-Prot	Medium
`Q6NQB7`	Arabidopsis thaliana	sp\|Q6NQB7\|B3GT7_ARATH Beta-1,3-galactosyltransferase 7	45.700%	Swiss-Prot	Medium
`Q9C809`	Arabidopsis thaliana	sp\|Q9C809\|B3GT8_ARATH Probable beta-1,3-galactosyltransferase 8	41.600%	Swiss-Prot	Medium
`A8MRC7`	Arabidopsis thaliana	sp\|A8MRC7\|B3GT2_ARATH Probable beta-1,3-galactosyltransferase 2	38.200%	Swiss-Prot	Medium
`Q8LEJ9`	Arabidopsis thaliana	sp\|Q8LEJ9\|B3GT4_ARATH Probable beta-1,3-galactosyltransferase 4	37.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card