RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G444430
Reference: TK1151 Chr: Chr04 Coordinates: 112031435-112032980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

639 bp · TkA04G444430|TK1151|cDNA

ATGGCACTGAACCATCTTCAACCTCCCCTTCTATATTTACCCTTCATCTCTCCCTCATTTTGGTGGAAATTAAGACAACTTCGGCGAGTAGCACCATCACGATTTTTCCTTGAATCCGACAATGCTCCTCCTTCCGTAGGGATTAATTTTGATGGAGCTGGTAGGGCTTACAAATTGAGAGAGAAAGAGGGAGCCGATGAAAAAATGACGGAGAGTAGAGGATCCAAAATCAATAACCCGCCTGCACGCTTCTCTCCCAC...

CDS

Download CDS FASTA

639 bp · TkA04G444430|TK1151|CDS

ATGGCACTGAACCATCTTCAACCTCCCCTTCTATATTTACCCTTCATCTCTCCCTCATTTTGGTGGAAATTAAGACAACTTCGGCGAGTAGCACCATCACGATTTTTCCTTGAATCCGACAATGCTCCTCCTTCCGTAGGGATTAATTTTGATGGAGCTGGTAGGGCTTACAAATTGAGAGAGAAAGAGGGAGCCGATGAAAAAATGACGGAGAGTAGAGGATCCAAAATCAATAACCCGCCTGCACGCTTCTCTCCCAC...

Protein

Download Protein FASTA

212 aa · TkA04G444430|TK1151|PROTEIN

MALNHLQPPLLYLPFISPSFWWKLRQLRRVAPSRFFLESDNAPPSVGINFDGAGRAYKLREKEGADEKMTESRGSKINNPPARFSPTRLSFCQHQISPLCSVFIRRVSLQLNTNPHLINKFIFSRRIDSQLMLVLEIHIEDISSLLQLIFSSCIRVETVLSMGVRLSVVDFVQTAKKESVSKEELGAKDISPYDVYSYNNIPRNSMPHVIRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G444430
TK1151 IDTkA04G444430
OH-1004 IDLXL04_033904
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)98.100
Protein coverage (%)TK1151 100.000 / OH-1004 78.810
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G444430
LocationChr04:112031435-112032980 (+)
DescriptionSimilar to EMF2B: Polycomb group protein EMF2B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_033904 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006325 chromatin organization Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0009409 response to cold Biological Process
GO:0009908 flower development Biological Process
GO:0009910 negative regulation of flower development Biological Process
GO:0010048 vernalization response Biological Process
GO:0030154 cell differentiation Biological Process
GO:0031507 heterochromatin formation Biological Process
GO:0048586 regulation of long-day photoperiodism, flowering Biological Process
GO:0141044 epigenetic programming in the endosperm Biological Process
GO:0005634 nucleus Cellular Component
GO:0005677 chromatin silencing complex Cellular Component
KEGG gene cross-reference
ath:AT4G16845
ath:AT5G51230
dosa:Os04g0162100
dosa:Os09g0306800
osa:4335036
osa:4346674
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.365
Rank 1 · TkA04G444430 · TK1151
Cytoplasm0.295
Rank 2 · TkA04G444430 · TK1151
Plastid0.134
Rank 3 · TkA04G444430 · TK1151
Mitochondrion0.122
Rank 4 · TkA04G444430 · TK1151
Cell membrane0.116
Rank 5 · TkA04G444430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser