TkA04G444060 | RubberDandelionOmics

Gene overview

TkA04G444060

Reference: TK1151 Chr: Chr04 Coordinates: 111951253-111952337 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

774 bp · TkA04G444060|TK1151|cDNA

ATGGGACCATCCACCTCTGAACTTGGCGGAGTTGCTCTGATTGTTTCAATTCTAATGGTAGCAGCATCGGCAGGAAGTTTTCACGATGATATTGACATCACATTTAGAGGCGAACGCGCTAAAATTCTGAATGGGGGTCAGGATCTTTCTCTTTCTCTGGACCAATACTCTGGCACTGGTTTCCAGTCAAAGCACGAGTACCTCTTCGGAAGATTCGACATGCAACTCAAACTCGTACCAGGCAACTCCGCTGGCACCGT...

CDS

Download CDS FASTA

774 bp · TkA04G444060|TK1151|CDS

ATGGGACCATCCACCTCTGAACTTGGCGGAGTTGCTCTGATTGTTTCAATTCTAATGGTAGCAGCATCGGCAGGAAGTTTTCACGATGATATTGACATCACATTTAGAGGCGAACGCGCTAAAATTCTGAATGGGGGTCAGGATCTTTCTCTTTCTCTGGACCAATACTCTGGCACTGGTTTCCAGTCAAAGCACGAGTACCTCTTCGGAAGATTCGACATGCAACTCAAACTCGTACCAGGCAACTCCGCTGGCACCGT...

Protein

Download Protein FASTA

257 aa · TkA04G444060|TK1151|PROTEIN

MGPSTSELGGVALIVSILMVAASAGSFHDDIDITFRGERAKILNGGQDLSLSLDQYSGTGFQSKHEYLFGRFDMQLKLVPGNSAGTVTTFYQFHLWFDPTAAHPETLTPSTPMCIRKGKETKNSSSTCATPWENPSFATASTPTPSSRTTKESLRVFHNNDVAGVPFPKSQPMRVYASLRNADDWATQGGRVKTDWTKAPFTASYRKFNVNGNRVGLNSLSTTSEKKNQAWATQDIDAAGRNRIRWVQTKHMIYNYC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G444060`
TK1151 ID	TkA04G444060
OH-1004 ID	LXL04_038587
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	80.200
Protein coverage (%)	TK1151 95.331 / OH-1004 73.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G444060

Location Chr04:111951253-111952337 (-)

Description Similar to XTH15: Xyloglucan endotransglucosylase/hydrolase protein 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14130`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	Distinct catalytic capacities of two aluminium-repressed Arabidopsis thaliana xyloglucan endotransglucosylase/hydrolases, XTH15 and XTH31, heterologously produced in Pichia.2015 · DOI: 10.1016/j.phytochem.2014.09.020
`At4g30270`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At3g23730`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009828 plant-type cell wall loosening Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010218 response to far red light Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071669 plant-type cell wall organization or biogenesis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT3G23730

ath:AT4G14130

ath:AT4G30270

gmx:547802

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.814

Rank 1 · TkA04G444060 · TK1151

Cytoplasm0.065

Rank 2 · TkA04G444060 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkA04G444060 · TK1151

Cell membrane0.048

Rank 4 · TkA04G444060 · TK1151

Lysosome / Vacuole0.035

Rank 5 · TkA04G444060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722Glyco_hydro_1616-40 aa

PF00722Glyco_hydro_1628-92 aa

PF1612240S_SA_C99-141 aa

PF06193Orthopox_A5L102-149 aa

PF1612240S_SA_C132-203 aa

PF00722Glyco_hydro_16153-198 aa

PF1612240S_SA_C227-234 aa

PF06955XET_C228-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G444060	`PF00722`	Glyco_hydro_16	16	40	5.3e-24	85.3
TkA04G444060	`PF00722`	Glyco_hydro_16	28	92	5.3e-24	85.3
TkA04G444060	`PF16122`	40S_SA_C	99	141	9.9	8.3
TkA04G444060	`PF06193`	Orthopox_A5L	102	149	0.49	10.5
TkA04G444060	`PF16122`	40S_SA_C	132	203	9.9	8.3
TkA04G444060	`PF00722`	Glyco_hydro_16	153	198	5.3e-24	85.3
TkA04G444060	`PF16122`	40S_SA_C	227	234	9.9	8.3
TkA04G444060	`PF06955`	XET_C	228	257	1.9e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38911`	Arabidopsis thaliana	sp\|Q38911\|XTH15_ARATH Xyloglucan endotransglucosylase/hydrolase protein 15	42.100%	Swiss-Prot	Medium
`P24806`	Arabidopsis thaliana	sp\|P24806\|XTH24_ARATH Xyloglucan endotransglucosylase/hydrolase protein 24	41.300%	Swiss-Prot	Medium
`Q8LG58`	Arabidopsis thaliana	sp\|Q8LG58\|XTH16_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 16	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card