Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3040 bp · TkA04G443450|TK1151|cDNA
CAGAGTTCAAACACTAGATTACATCTCTAGATCCTGAAAAGACATTAATACCCTTGCATCCTCATACTTTGTTTCCGCATTTCCCTTATAAAAATGAAGTCCTTTTCCGTCAAAAAGAAAAAATCTGCTACCCTTTTTTAACCCTCCAACATCCCGACCACTCTTTACGGCCGCCATGGCTACTTTCCGAGCGTGGTTTGATTTGTAGAGAGAGAAACCATTATGGACCCCCATAGCTTCATAGCTCGGGCGGAAGCGCA...
2751 bp · TkA04G443450|TK1151|CDS
ATGGACCCCCATAGCTTCATAGCTCGGGCGGAAGCGCAACGATGGCTTGGTATCGCCGAGAAGCTGCTAATGGGCCACGACCTCGTCGGCTCCAAGACATTTGCGATCCGAGCACGAGATTCCGATCCCAGACTTGAAGCTGCTGAACAGATCTTAGCAATAGCTGATACGCTCCTCGCCGCAGAGAAACGAGTTGTTGGAAACAACGGCACTCAGCAGCCGGATTACTACGCGATTCTCCAACTCGTCAGGTTCGTTCA...
Protein
Download Protein FASTA916 aa · TkA04G443450|TK1151|PROTEIN
MDPHSFIARAEAQRWLGIAEKLLMGHDLVGSKTFAIRARDSDPRLEAAEQILAIADTLLAAEKRVVGNNGTQQPDYYAILQLVRFVQDTDQIASQFRRLAVMLNPHQNRFPYSDQAFQLVNDAWAVLSNPMRKSMYDSELDFPPQQQMNTIGFNLEQQHHHQQHHHQQQQQQQHNFFSINHMGSSHEQELPEPQQTFQTRVQQSHQQQQLQQHNFLSQPSPVRQEQLFQHREQEHLFQPQAQPFQVSSPPHQQTRQPPQP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G443450 |
|---|---|
| TK1151 ID | TkA04G443450 |
| OH-1004 ID | LXL04_038580 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 96.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G443450 |
|---|---|
| Location | Chr04:111798557-111801952 (+) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0003300 cardiac muscle hypertrophy Biological Process GO:0006936 muscle contraction Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0035995 detection of muscle stretch Biological Process GO:0043056 forward locomotion Biological Process GO:0050714 positive regulation of protein secretion Biological Process GO:0051592 response to calcium ion Biological Process GO:0060048 cardiac muscle contraction Biological Process GO:1901897 regulation of relaxation of cardiac muscle Biological Process GO:0000794 condensed nuclear chromosome Cellular Component GO:0009986 cell surface Cellular Component GO:0002020 protease binding Molecular Function |
| KEGG gene cross-reference | bpe:BP1879 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00226DnaJ75-137 aaPF23551Zn_ribbon_20636-670 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G443450 | PF00226 | DnaJ | 75 | 137 | 6.6e-12 | 46.1 |
| TkA04G443450 | PF23551 | Zn_ribbon_20 | 636 | 670 | 1.2e-08 | 35.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.