TkA04G442650 | RubberDandelionOmics

Gene overview

TkA04G442650

Reference: TK1151 Chr: Chr04 Coordinates: 111618889-111621211 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1824 bp · TkA04G442650|TK1151|cDNA

CATAAACCCAACTTTAATTCTCACGATCGACTTCCACGTCACTGAATCCTACGTGTACCAATCATATCCCCCCTACGTATCATATCGGCGTCATTCCCACGGTCTCTAGAATCATCTTCTTCACCGTTTTGCCTCTATCTATTGAAGTTTAAAATCTCAAGAATTCGTTACGAACTCCAAATCGAATCTCTATTTATTTGCCATTGAATTTATCAAAACAAAATTATAATCCTCTTCGCCAGTTTTCAATTGAGGATTAC...

CDS

Download CDS FASTA

1293 bp · TkA04G442650|TK1151|CDS

ATGGCTGTTAGGGTTTCGAGTTTCGCATGTTATGTGTGTTTGCTCGCGTTGATAATACAAGTTTCTGGTTCAAGAGCTCTAAACTCGATGCCGGAGGTTCATCGTCATTATCCTAAAGCTTTATCTGATTTGAAGGATGCTATCGTCAAAGGATTAGGGATTCAATCAGAAAACCTCAACTTATTTGGATTTGATTTGAAGGGCGCCTTGGTAGCACAATCCATGGAGTTTGATCTACAAGTTGATAACAATATTCTTCC...

Protein

Download Protein FASTA

430 aa · TkA04G442650|TK1151|PROTEIN

MAVRVSSFACYVCLLALIIQVSGSRALNSMPEVHRHYPKALSDLKDAIVKGLGIQSENLNLFGFDLKGALVAQSMEFDLQVDNNILPIKLLDDVNKWEHVDLPTFLVEDPVRLSDEKGLVEKNRLSGKSLPSLPPFQLAGPMELWIQDAKDMRLFLPHDVDAGELKKVILADGAVVTVKGAKSVSLRHPIELPLPFNKTNNLFASGLLTLSDHLRQASLTGKQLLSLRITGPTSLSSPATSSPSFNKLKLKRLAPGLVEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G442650`
TK1151 ID	TkA04G442650
OH-1004 ID	LXL04_038565
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G442650

Location Chr04:111618889-111621211 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64510`	Involved in the regulation of pollen surface morphology, probably by modulating the secretion of proteins and/or lipids during pollen development.	Overexpression of the endoplasmic reticulum stress-inducible gene TIN1 causes abnormal pollen surface morphology in Arabidopsis.2017 · DOI: 10.5511/plantbiotechnology.17.0823b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038565 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G64510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.268

Rank 1 · TkA04G442650 · TK1151

Cytoplasm0.179

Rank 2 · TkA04G442650 · TK1151

Golgi apparatus0.171

Rank 3 · TkA04G442650 · TK1151

Nucleus0.151

Rank 4 · TkA04G442650 · TK1151

Extracellular0.127

Rank 5 · TkA04G442650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28340TIN171-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G442650	`PF28340`	TIN1	71	419	2e-143	478.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JN2`	Arabidopsis thaliana	sp\|Q84JN2\|TIN1_ARATH Protein TUNICAMYCIN INDUCED 1	55.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card