RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G441830
Reference: TK1151 Chr: Chr04 Coordinates: 111405791-111406894 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

900 bp · TkA04G441830|TK1151|cDNA

ATGGAGACGTGGACTAATGTAGGTCGGTCTATCTTGCTCTAAAAATAGTGACACAAGACAAGCTGATGTTAAAGAACGAGTCACAACTCACATCGAATCGGTCTTCTCGTTACCCTCACGGATGACGTCAATGTTGGGTTCTACTTCCACCCCTTTATCTCGAATCTTCCCACCGTCAATACTCAATCGCAGCAATCTCTTCACCACCCATTTGAAATCGAGTCGAGATTCGTACAAGAAAATCGTCAATTTTGCCGGAA...

CDS

Download CDS FASTA

609 bp · TkA04G441830|TK1151|CDS

ATGACGTCAATGTTGGGTTCTACTTCCACCCCTTTATCTCGAATCTTCCCACCGTCAATACTCAATCGCAGCAATCTCTTCACCACCCATTTGAAATCGAGTCGAGATTCGTACAAGAAAATCGTCAATTTTGCCGGAATAAGGTTTGGGTCTGTTACCCGGGTTCCATATCGAAGTAACAGAGGGTTTAGAAGCGGAATTGTGGCTATGGCAGGTTCGGATGCCGTTCAGAAATCGGAGGACGAGTGGCGTGCGGTTCT...

Protein

Download Protein FASTA

202 aa · TkA04G441830|TK1151|PROTEIN

MTSMLGSTSTPLSRIFPPSILNRSNLFTTHLKSSRDSYKKIVNFAGIRFGSVTRVPYRSNRGFRSGIVAMAGSDAVQKSEDEWRAVLSPEQFRILRQKGTEYPGTGQYNKFYEEGVYTCAGCGTPLYKSTTKFDSGCGWPAFYEGLPGAINRHADPDGMRVEITCAACGGHLGHVFKGEGFRTPTDERHCVNSISLKFTPEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G441830
TK1151 IDTkA04G441830
OH-1004 IDLXL04_038558
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G441830
LocationChr04:111405791-111406894 (+)
DescriptionSimilar to MSRB2: Peptide methionine sulfoxide reductase B2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g21860 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.
The Arabidopsis plastidic methionine sulfoxide reductase B proteins. Sequence and activity characteristics, comparison of the expression with plastidic methionine sulfoxide reductase A, and induction by photooxidative stress.2005 · DOI: 10.1104/pp.105.062430
Specificity of thioredoxins and glutaredoxins as electron donors to two distinct classes of Arabidopsis plastidial methionine sulfoxide reductases B.2007 · DOI: 10.1016/j.febslet.2007.07.081
Regeneration mechanisms of Arabidopsis thaliana methionine sulfoxide reductases B by glutaredoxins and thioredoxins.2009 · DOI: 10.1074/jbc.m109.015487
Arabidopsis thaliana plastidial methionine sulfoxide reductases B, MSRBs, account for most leaf peptide MSR activity and are essential for growth under environmental constraints through a role in the preservation of photosystem antennae.2010 · DOI: 10.1111/j.1365-313x.2009.04053.x
At4g04800 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.
Role of the methionine sulfoxide reductase MsrB3 in cold acclimation in Arabidopsis.2007 · DOI: 10.1093/pcp/pcm143
At4g04830 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0360700 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. No verified direct reference in this release
Os05g0404200 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038558 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006979 response to oxidative stress Biological Process
GO:0009631 cold acclimation Biological Process
GO:0030091 protein repair Biological Process
GO:0034599 cellular response to oxidative stress Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0033743 peptide-methionine (R)-S-oxide reductase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT4G04800
ath:AT4G04830
ath:AT4G21860
dosa:Os03g0360700
dosa:Os05g0404200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982
Rank 1 · TkA04G441830 · TK1151
Mitochondrion0.034
Rank 2 · TkA04G441830 · TK1151
Cytoplasm0.018
Rank 3 · TkA04G441830 · TK1151
Nucleus0.014
Rank 4 · TkA04G441830 · TK1151
Peroxisome0.012
Rank 5 · TkA04G441830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24046At4g0833021-49 aa
PF08271Zn_Ribbon_TF79-85 aa
PF01641SelR87-200 aa
PF08271Zn_Ribbon_TF112-124 aa
PF22289DmmA-like_C113-126 aa
PF26237DUF8054_C115-127 aa
PF24046At4g08330115-129 aa
PF13824zf-Mss51117-134 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G441830PF24046At4g0833021490.09513.5
TkA04G441830PF08271Zn_Ribbon_TF79853.08.2
TkA04G441830PF01641SelR872001.6e-45154.6
TkA04G441830PF08271Zn_Ribbon_TF1121243.08.2
TkA04G441830PF22289DmmA-like_C1131260.09913.3
TkA04G441830PF26237DUF8054_C1151270.04514.4
TkA04G441830PF24046At4g083301151290.09513.5
TkA04G441830PF13824zf-Mss511171340.05914.3
TkA04G441830PF06677Auto_anti-p271181302.98.8
TkA04G441830PF13824zf-Mss511361420.05914.3
TkA04G441830PF08271Zn_Ribbon_TF1571693.08.2
TkA04G441830PF13824zf-Mss511581690.05914.3
TkA04G441830PF24046At4g083301591790.09513.5
TkA04G441830PF22289DmmA-like_C1621720.09913.3
TkA04G441830PF06677Auto_anti-p271621692.98.8
TkA04G441830PF26237DUF8054_C1631720.04514.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C5C8Arabidopsis thalianasp|Q9C5C8|MSRB2_ARATH Peptide methionine sulfoxide reductase B2, chloroplastic80.700%Swiss-ProtHigh
Q9M0Z6Arabidopsis thalianasp|Q9M0Z6|MSRB3_ARATH Peptide methionine sulfoxide reductase B377.400%Swiss-ProtMedium
Q9ZS91Arabidopsis thalianasp|Q9ZS91|MSRB5_ARATH Peptide methionine sulfoxide reductase B580.800%Swiss-ProtMedium
Q10L32Oryza sativa subsp. japonicasp|Q10L32|MSRB5_ORYSJ Peptide methionine sulfoxide reductase B585.200%Swiss-ProtMedium
Q6AUK5Oryza sativa subsp. japonicasp|Q6AUK5|MSRB3_ORYSJ Peptide methionine sulfoxide reductase B3, chloroplastic83.300%Swiss-ProtMedium

JBrowse

View in Genome Browser