Gene Card
Gene overview
cDNA / CDS / Protein Sequences
591 bp · TkA04G441770|TK1151|cDNA
ATGAATCCATACCTACGTAACACCTCTTTTCCAAACGCATACTTGACACAATATCCACAGTATTCCCACCACTCTAATTTCCCGTTCAATGGCTACCTGAACCTCGATACTCATACCCACCAACGTCCGGTGCCCGGAGGACGGAACTCTGCTAAATGGTCTGTAGATGAAGACGAAGTAGTTATTCTCGACAGTCTCGACATGTATTCACCACCGCCGCCGCCGCAGCCATCTTTCTCCATCCGTACACACCAACCGCT...
591 bp · TkA04G441770|TK1151|CDS
ATGAATCCATACCTACGTAACACCTCTTTTCCAAACGCATACTTGACACAATATCCACAGTATTCCCACCACTCTAATTTCCCGTTCAATGGCTACCTGAACCTCGATACTCATACCCACCAACGTCCGGTGCCCGGAGGACGGAACTCTGCTAAATGGTCTGTAGATGAAGACGAAGTAGTTATTCTCGACAGTCTCGACATGTATTCACCACCGCCGCCGCCGCAGCCATCTTTCTCCATCCGTACACACCAACCGCT...
Protein
Download Protein FASTA196 aa · TkA04G441770|TK1151|PROTEIN
MNPYLRNTSFPNAYLTQYPQYSHHSNFPFNGYLNLDTHTHQRPVPGGRNSAKWSVDEDEVVILDSLDMYSPPPPPQPSFSIRTHQPLQFMGGRGHHQQSSEIIDEVVILENLNTNENSRLGGLTKEVISKNLKLKQINCSEEDDKDEICVICQVGFERKEMVGVLECKHCYHVECINEWLFHKNVCPLCKTRVFIV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G441770 |
|---|---|
| TK1151 ID | TkA04G441770 |
| OH-1004 ID | LXL04_038554 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G441770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:111388697-111389287 (+) | |||||||||
| Description | Similar to RHG1A: Probable E3 ubiquitin-protein ligase RHG1A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009845 seed germination Biological Process GO:0009908 flower development Biological Process GO:0010218 response to far red light Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function GO:0061659 ubiquitin-like protein ligase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G15530 ath:AT4G34040 ath:AT5G42940 dosa:Os01g0667700 dosa:Os04g0648800 osa:4326322 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22766ZW10_C2100-165 aaPF13901RH_dom109-191 aaPF12678zf-rbx1146-190 aaPF13920zf-C3HC4_3146-193 aaPF17122zf-C3H2C3146-152 aaPF17120zf-RING_16148-187 aaPF13639zf-RING_2149-190 aaPF17123zf-RING_11149-176 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G441770 | PF22766 | ZW10_C2 | 100 | 165 | 0.19 | 12.5 |
| TkA04G441770 | PF13901 | RH_dom | 109 | 191 | 0.039 | 14.5 |
| TkA04G441770 | PF12678 | zf-rbx1 | 146 | 190 | 4.5e-08 | 33.9 |
| TkA04G441770 | PF13920 | zf-C3HC4_3 | 146 | 193 | 0.00052 | 20.5 |
| TkA04G441770 | PF17122 | zf-C3H2C3 | 146 | 152 | 2.4 | 9.0 |
| TkA04G441770 | PF17120 | zf-RING_16 | 148 | 187 | 0.0029 | 17.9 |
| TkA04G441770 | PF13639 | zf-RING_2 | 149 | 190 | 2.9e-11 | 44.1 |
| TkA04G441770 | PF17123 | zf-RING_11 | 149 | 176 | 3.3e-06 | 27.4 |
| TkA04G441770 | PF13923 | zf-C3HC4_2 | 149 | 189 | 1.4e-05 | 25.5 |
| TkA04G441770 | PF14634 | zf-RING_5 | 149 | 191 | 0.0002 | 22.0 |
| TkA04G441770 | PF00097 | zf-C3HC4 | 149 | 189 | 0.00027 | 21.5 |
| TkA04G441770 | PF12861 | zf-ANAPC11 | 149 | 192 | 0.006 | 17.3 |
| TkA04G441770 | PF13445 | zf-RING_UBOX | 149 | 187 | 0.0086 | 16.8 |
| TkA04G441770 | PF00628 | PHD | 149 | 179 | 0.037 | 14.8 |
| TkA04G441770 | PF23412 | zf_RING_Vps8 | 149 | 178 | 0.075 | 13.6 |
| TkA04G441770 | PF23004 | PHDvar_NSD | 149 | 178 | 1.0 | 10.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.