TkA04G441760 | RubberDandelionOmics

Gene overview

TkA04G441760

Reference: TK1151 Chr: Chr04 Coordinates: 111383850-111387716 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA04G441760|TK1151|cDNA

ATGAATTCAGATACTAATATTTCGAGTGTTGTTTCTATCACGTTATTTTTCCATTTATTAGTTTTTAGTGTAAAAAACAGGGGTGGAATATGCATATGGGCAGCTTCATATCCTGGAAACATAGCATGTGTTAGACCAGGGGTTAATTCTGGAAGCGTCTCTAGAGGTTCAGGAGTTAAATTGATTGTAGTGGATTTTCTTCGAGGCAATAATGATGAACAAATAACTGCACTCTCATGGAGTCTTGATGGAAGATATGT...

CDS

Download CDS FASTA

456 bp · TkA04G441760|TK1151|CDS

ATGAATTCAGATACTAATATTTCGAGTGTTGTTTCTATCACGTTATTTTTCCATTTATTAGTTTTTAGTGTAAAAAACAGGGGTGGAATATGCATATGGGCAGCTTCATATCCTGGAAACATAGCATGTGTTAGACCAGGGGTTAATTCTGGAAGCGTCTCTAGAGGTTCAGGAGTTAAATTGATTGTAGTGGATTTTCTTCGAGGCAATAATGATGAACAAATAACTGCACTCTCATGGAGTCTTGATGGAAGATATGT...

Protein

Download Protein FASTA

151 aa · TkA04G441760|TK1151|PROTEIN

MNSDTNISSVVSITLFFHLLVFSVKNRGGICIWAASYPGNIACVRPGVNSGSVSRGSGVKLIVVDFLRGNNDEQITALSWSLDGRYVASASYRSSSFTIWDVAQGVGTPIRRGFRSISLLKWSPIISFLQNGRDGTFYLWETNTWTSELFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G441760`
TK1151 ID	TkA04G441760
OH-1004 ID	LXL04_036173
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.200
Protein coverage (%)	TK1151 85.430 / OH-1004 26.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G441760

Location Chr04:111383850-111387716 (+)

Description Similar to AAAS: Aladin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56900`	Aladin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036173 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009566 fertilization Biological Process

GO:0015031 protein transport Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0046822 regulation of nucleocytoplasmic transport Biological Process

GO:0051028 mRNA transport Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:1902365 positive regulation of protein localization to spindle pole body Biological Process

GO:0000922 spindle pole Cellular Component

KEGG gene cross-reference

ath:AT3G56900

dme:Dmel_CG16892

hsa:8086

mmu:223921

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · TkA04G441760 · TK1151

Nucleus0.401

Rank 2 · TkA04G441760 · TK1151

Golgi apparatus0.093

Rank 3 · TkA04G441760 · TK1151

Cell membrane0.092

Rank 4 · TkA04G441760 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA04G441760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24817WD40_WDHD1_1st23-34 aa

PF24105Beta-prop_CAF1B_HIR161-106 aa

PF12894ANAPC4_WD4063-122 aa

PF25460Beta-prop_Aladin64-149 aa

PF00400WD4066-101 aa

PF24817WD40_WDHD1_1st70-124 aa

PF24807WD40_CDC20-Fz70-143 aa

PF23414Beta-prop_EML_271-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G441760	`PF24817`	WD40_WDHD1_1st	23	34	5.6e-05	23.2
TkA04G441760	`PF24105`	Beta-prop_CAF1B_HIR1	61	106	0.0016	18.2
TkA04G441760	`PF12894`	ANAPC4_WD40	63	122	0.0084	17.0
TkA04G441760	`PF25460`	Beta-prop_Aladin	64	149	5.2e-13	49.6
TkA04G441760	`PF00400`	WD40	66	101	8.4e-05	23.7
TkA04G441760	`PF24817`	WD40_WDHD1_1st	70	124	5.6e-05	23.2
TkA04G441760	`PF24807`	WD40_CDC20-Fz	70	143	0.0082	16.2
TkA04G441760	`PF23414`	Beta-prop_EML_2	71	128	0.027	14.6
TkA04G441760	`PF25168`	Beta-prop_WDR36-Utp21_2nd	71	144	0.041	13.9
TkA04G441760	`PF24780`	WD40_MABP1-WDR62_1st	71	105	0.086	12.8
TkA04G441760	`PF23389`	Beta-prop_WDR19_1st	72	142	4.1e-05	23.5
TkA04G441760	`PF23381`	Beta-prop_IFT122_1st	72	143	0.0003	20.9
TkA04G441760	`PF25175`	Beta-prop_WDR5	72	144	0.00076	19.6
TkA04G441760	`PF10282`	Lactonase	72	104	0.38	10.6
TkA04G441760	`PF25174`	Beta-prop_THOC3	73	144	8.2e-05	22.5
TkA04G441760	`PF25173`	Beta-prop_WDR3_1st	73	108	0.076	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWR1`	Arabidopsis thaliana	sp\|Q8GWR1\|AAAS_ARATH Aladin	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card