TkA04G437510 | RubberDandelionOmics

Gene overview

TkA04G437510

Reference: TK1151 Chr: Chr04 Coordinates: 110358712-110359892 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · TkA04G437510|TK1151|cDNA

ATGGCGGCATCATCCATCTCTCTATCACCAGCGTCATCATCTCGGCTCTCTCCAACCATTTCTCGGCCACGATCACCACAACATCTCTCCTTCTCTTCCTATACCTTCATCCCCACATTTCGGCTTCAACCTCATGGTCACCGTCTCCAAGCTACTCGCCGTCCTCAAAATTTCTCTCAGGAAGGTGAGAATCCGGCGGCGGATCCTCGGATATGGAATCGGAATCGTAACGATATGACTTTTTCCGGAGATTACGATGA...

CDS

Download CDS FASTA

594 bp · TkA04G437510|TK1151|CDS

ATGGCGGCATCATCCATCTCTCTATCACCAGCGTCATCATCTCGGCTCTCTCCAACCATTTCTCGGCCACGATCACCACAACATCTCTCCTTCTCTTCCTATACCTTCATCCCCACATTTCGGCTTCAACCTCATGGTCACCGTCTCCAAGCTACTCGCCGTCCTCAAAATTTCTCTCAGGAAGGTGAGAATCCGGCGGCGGATCCTCGGATATGGAATCGGAATCGTAACGATATGACTTTTTCCGGAGATTACGATGA...

Protein

Download Protein FASTA

197 aa · TkA04G437510|TK1151|PROTEIN

MAASSISLSPASSSRLSPTISRPRSPQHLSFSSYTFIPTFRLQPHGHRLQATRRPQNFSQEGENPAADPRIWNRNRNDMTFSGDYDEDDDEDDDEEEDDRSMDLLIRFVENVFKKISKRARKAVRSVLPINIPTKLVGFSVNGVIILAFFWILKAFLEVVCTLGSVVFVSILLVRGVITGGQMILMMGIRHGMELSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G437510`
TK1151 ID	TkA04G437510
OH-1004 ID	LXL04_038514
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 62.437 / OH-1004 72.781 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G437510

Location Chr04:110358712-110359892 (+)

Description Similar to SHW1: Protein SHORT HYPOCOTYL IN WHITE LIGHT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69935`	Negative regulator of photomorphogenesis modulating both light and abscisic acid (ABA) signaling pathways.	SHORT HYPOCOTYL IN WHITE LIGHT1, a serine-arginine-aspartate-rich protein in Arabidopsis, acts as a negative regulator of photomorphogenic growth.2008 · DOI: 10.1104/pp.108.118174 SHW1, a common regulator of abscisic acid (ABA) and light signaling pathways.2008 · DOI: 10.4161/psb.3.10.6038 Short Hypocotyl in White Light1 Interacts with Elongated Hypocotyl5 (HY5) and Constitutive Photomorphogenic1 (COP1) and Promotes COP1-Mediated Degradation of HY5 during Arabidopsis Seedling Development.2015 · DOI: 10.1104/pp.15.01184

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038514 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009642 response to light intensity Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010100 negative regulation of photomorphogenesis Biological Process

GO:0010380 regulation of chlorophyll biosynthetic process Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process

GO:0090227 regulation of red or far-red light signaling pathway Biological Process

GO:1901333 positive regulation of lateral root development Biological Process

KEGG gene cross-reference

ath:AT1G69935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.965

Rank 1 · TkA04G437510 · TK1151

Nucleus0.047

Rank 2 · TkA04G437510 · TK1151

Mitochondrion0.024

Rank 3 · TkA04G437510 · TK1151

Cytoplasm0.021

Rank 4 · TkA04G437510 · TK1151

Cell membrane0.015

Rank 5 · TkA04G437510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04889Cwf_Cwc_1567-114 aa

PF06524NOA3674-100 aa

PF18829Importin_rep_675-129 aa

PF17828FAS_N81-128 aa

PF15451DUF463282-132 aa

PF04931DNA_pol_phi84-115 aa

PF17388GP24_2588-125 aa

PF28670SHW1_helical90-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G437510	`PF04889`	Cwf_Cwc_15	67	114	0.14	12.7
TkA04G437510	`PF06524`	NOA36	74	100	1.7	8.7
TkA04G437510	`PF18829`	Importin_rep_6	75	129	0.0014	19.6
TkA04G437510	`PF17828`	FAS_N	81	128	0.26	12.2
TkA04G437510	`PF15451`	DUF4632	82	132	0.12	13.2
TkA04G437510	`PF04931`	DNA_pol_phi	84	115	2.8	6.7
TkA04G437510	`PF17388`	GP24_25	88	125	0.099	13.8
TkA04G437510	`PF28670`	SHW1_helical	90	179	5e-43	146.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I3V6`	Arabidopsis thaliana	sp\|F4I3V6\|SHW1_ARATH Protein SHORT HYPOCOTYL IN WHITE LIGHT 1	52.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card