RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G435910
Reference: TK1151 Chr: Chr04 Coordinates: 109922678-109923751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

717 bp · TkA04G435910|TK1151|cDNA

ATGGAATCTGTTTCTACTCTTTTAGAAGGAGAAAGGAACTACTTTAGTGAAACGTATAATGTGAGTGAAGAGGCTGGTTTCATGTCCCATTTACTTGGTAACTTTTCGAATAATTTACCTAAACCTTCTTCCACTTTTGAAGACTCTTCTTCTTCCTCTTCTTCTGCATTTTGGTCACCTTCAATATCCATGCCTTGTTTCCAAGACACTTATACAGATAACAACACTCTTCTTTTTCCCACTTCAAGTGGTGAAAGTTA...

CDS

Download CDS FASTA

717 bp · TkA04G435910|TK1151|CDS

ATGGAATCTGTTTCTACTCTTTTAGAAGGAGAAAGGAACTACTTTAGTGAAACGTATAATGTGAGTGAAGAGGCTGGTTTCATGTCCCATTTACTTGGTAACTTTTCGAATAATTTACCTAAACCTTCTTCCACTTTTGAAGACTCTTCTTCTTCCTCTTCTTCTGCATTTTGGTCACCTTCAATATCCATGCCTTGTTTCCAAGACACTTATACAGATAACAACACTCTTCTTTTTCCCACTTCAAGTGGTGAAAGTTA...

Protein

Download Protein FASTA

238 aa · TkA04G435910|TK1151|PROTEIN

MESVSTLLEGERNYFSETYNVSEEAGFMSHLLGNFSNNLPKPSSTFEDSSSSSSSAFWSPSISMPCFQDTYTDNNTLLFPTSSGESYPSMGSSKGNSVIPCFSKKRSFSFDDVQMGWKKTKFTNIHDSDDECNRPKEEAMVNSSCKKRANNGTASDSQSVYAKKRRERINERLRILQSLVPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDELWMYAPLAYNGMNIGLLDVNLPSPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G435910
TK1151 IDTkA04G435910
OH-1004 IDLXL04_038495
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)95.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G435910
LocationChr04:109922678-109923751 (+)
DescriptionSimilar to BHLH84: Transcription factor bHLH84
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g14760 Transcription factor bHLH84. No verified direct reference in this release
At4g33880 Transcription factor involved in the regulation of root hair elongation.
A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3
At5g43175 Transcription factor bHLH139. No verified direct reference in this release
At1g27740 Transcription factor involved in the regulation of root hair elongation.
A basic helix-loop-helix transcription factor controls cell growth and size in root hairs.2010 · DOI: 10.1038/ng.529
Intensity of a pulse of RSL4 transcription factor synthesis determines Arabidopsis root hair cell size.2015 · DOI: 10.1038/nplants.2015.138
ROOT HAIR DEFECTIVE SIX-LIKE4 (RSL4) promotes root hair elongation by transcriptionally regulating the expression of genes required for cell growth.2016 · DOI: 10.1111/nph.14095
A mechanistic framework for auxin dependent Arabidopsis root hair elongation to low external phosphate.2018 · DOI: 10.1038/s41467-018-03851-3

Rice

Reference gene IDPossible functionPapers / DOI
Os12g0508500 Transcription factor that acts as a regulator of iron homeostasis.
Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa.2013 · DOI: 10.1111/j.1365-3040.2012.02569.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038495 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009555 pollen development Biological Process
GO:0009733 response to auxin Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048766 root hair initiation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
KEGG gene cross-reference
ath:AT1G27740
ath:AT2G14760
ath:AT4G33880
ath:AT5G43175
osa:107276670
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.977
Rank 1 · TkA04G435910 · TK1151
Cytoplasm0.094
Rank 2 · TkA04G435910 · TK1151
Cell membrane0.024
Rank 3 · TkA04G435910 · TK1151
Endoplasmic reticulum0.015
Rank 4 · TkA04G435910 · TK1151
Plastid0.012
Rank 5 · TkA04G435910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08832SRC-157-57 aa
PF09808SNAPC1100-129 aa
PF04281Tom22122-201 aa
PF08832SRC-1134-190 aa
PF09808SNAPC1155-183 aa
PF23177bHLH_IRO3156-209 aa
PF00010HLH163-203 aa
PF23173bHLH_SAC51163-208 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G435910PF08832SRC-157570.6711.7
TkA04G435910PF09808SNAPC11001290.2612.1
TkA04G435910PF04281Tom221222010.01415.9
TkA04G435910PF08832SRC-11341900.6711.7
TkA04G435910PF09808SNAPC11551830.2612.1
TkA04G435910PF23177bHLH_IRO31562090.002718.7
TkA04G435910PF00010HLH1632033.7e-0937.0
TkA04G435910PF23173bHLH_SAC511632083.4e-0834.0
TkA04G435910PF23176bHLH_LHW1662038.1e-0626.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7XHI9Arabidopsis thalianasp|Q7XHI9|BH084_ARATH Transcription factor bHLH8482.000%Swiss-ProtLow
Q84WK0Arabidopsis thalianasp|Q84WK0|RSL2_ARATH Transcription factor RSL279.800%Swiss-ProtLow
Q3E7L7Arabidopsis thalianasp|Q3E7L7|BH139_ARATH Transcription factor bHLH13979.800%Swiss-ProtLow
Q8LEG1Arabidopsis thalianasp|Q8LEG1|RSL4_ARATH Transcription factor RSL380.700%Swiss-ProtLow
Q2QQ32Oryza sativa subsp. japonicasp|Q2QQ32|BH133_ORYSJ Transcription factor BHLH13348.900%Swiss-ProtMedium

JBrowse

View in Genome Browser