TkA04G433460 | RubberDandelionOmics

Gene overview

TkA04G433460

Reference: TK1151 Chr: Chr04 Coordinates: 109296726-109297355 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA04G433460|TK1151|cDNA

ATGAGTTGTAATGGCTGCCGAGTTCTCCGAAAAGGCTGCAATGACAACTGCATACTCAAGCAAAGCCTCTGTGCCATTGAAACTGCTCAAGCTCAATCCAACGCCACCTTGTTCGTTGCCAAATTCTTCGGCCGAGCCGGCCTTATGTCCTTCCTCTCCTCCGTTCCTGAGCTCCAACGACCAGCTTTATTTCAGTCTTTACTGTTCGAATCCTGTGGCCGGACGGTGAATCCAATGAACGGAGCAGTCGGCCTTCTGTG...

CDS

Download CDS FASTA

510 bp · TkA04G433460|TK1151|CDS

ATGAGTTGTAATGGCTGCCGAGTTCTCCGAAAAGGCTGCAATGACAACTGCATACTCAAGCAAAGCCTCTGTGCCATTGAAACTGCTCAAGCTCAATCCAACGCCACCTTGTTCGTTGCCAAATTCTTCGGCCGAGCCGGCCTTATGTCCTTCCTCTCCTCCGTTCCTGAGCTCCAACGACCAGCTTTATTTCAGTCTTTACTGTTCGAATCCTGTGGCCGGACGGTGAATCCAATGAACGGAGCAGTCGGCCTTCTGTG...

Protein

Download Protein FASTA

169 aa · TkA04G433460|TK1151|PROTEIN

MSCNGCRVLRKGCNDNCILKQSLCAIETAQAQSNATLFVAKFFGRAGLMSFLSSVPELQRPALFQSLLFESCGRTVNPMNGAVGLLWTGNWHVCESAVETVLRGGSIHAMPELFSVGASQAITESDNASEAINCNFEEHKLGFATSDFMVDARRSSACVSSNDQSLLEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G433460`
TK1151 ID	TkA04G433460
OH-1004 ID	LXL04_038479
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G433460

Location Chr04:109296726-109297355 (-)

Description Similar to LBD37: LOB domain-containing protein 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67420`	LOB domain-containing protein 37.	No verified direct reference in this release
`At4g37540`	LOB domain-containing protein 39.	No verified direct reference in this release
`At3g49940`	LOB domain-containing protein 38.	No verified direct reference in this release
`At1g67100`	LOB domain-containing protein 40.	No verified direct reference in this release
`At1g68510`	LOB domain-containing protein 42.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0060776 simple leaf morphogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001217 DNA-binding transcription repressor activity Molecular Function

KEGG gene cross-reference

ath:AT1G67100

ath:AT1G68510

ath:AT3G49940

ath:AT4G37540

ath:AT5G67420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.921

Rank 1 · TkA04G433460 · TK1151

Cytoplasm0.153

Rank 2 · TkA04G433460 · TK1151

Cell membrane0.028

Rank 3 · TkA04G433460 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA04G433460 · TK1151

Mitochondrion0.014

Rank 5 · TkA04G433460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB2-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G433460	`PF03195`	LOB	2	100	8.9e-23	81.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN11`	Arabidopsis thaliana	sp\|Q9FN11\|LBD37_ARATH LOB domain-containing protein 37	67.900%	Swiss-Prot	High
`Q9SZE8`	Arabidopsis thaliana	sp\|Q9SZE8\|LBD39_ARATH LOB domain-containing protein 39	58.000%	Swiss-Prot	High
`Q9SN23`	Arabidopsis thaliana	sp\|Q9SN23\|LBD38_ARATH LOB domain-containing protein 38	68.900%	Swiss-Prot	High
`Q9ZW96`	Arabidopsis thaliana	sp\|Q9ZW96\|LBD40_ARATH LOB domain-containing protein 40	60.700%	Swiss-Prot	Medium
`Q9CA30`	Arabidopsis thaliana	sp\|Q9CA30\|LBD42_ARATH LOB domain-containing protein 42	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card