TkA04G433160 | RubberDandelionOmics

Gene overview

TkA04G433160

Reference: TK1151 Chr: Chr04 Coordinates: 109217476-109224348 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2245 bp · TkA04G433160|TK1151|cDNA

ATCTTAACCACAACTCCATCATGTTCATGAACCAATTAGGGATTTTCTTGTTTTGGAGAAAACAGGATTTTCTTGATCTTTTCATGGCGTAAATCGACAATGTGAGGTGAGTTACTGAAATTTCATCTGGGTTTGCTTTTTTCGTGTGGTGTGTATGTATTTTCCTCGATGATGGTGGCTGCCGTTTCTGAAACAACAAACAGAAATCAAACGAGACCTCCATTGTTGCCGGCGGAAAAAGACAATGGAATCAGTGCCCC...

CDS

Download CDS FASTA

1002 bp · TkA04G433160|TK1151|CDS

ATGATGGTGGCTGCCGTTTCTGAAACAACAAACAGAAATCAAACGAGACCTCCATTGTTGCCGGCGGAAAAAGACAATGGAATCAGTGCCCCTAATAAGTCAATTAGACCGAAACCACGACAAGTTACTTCAAGATACCTTTCTCCTTCACCTTCAACTTCTTCACATTCATATTCGAATTCAAATTCATCATCTCTACCCACATTACGGAGGTCTCCGTCTCCTTTAATTTCACGAAATTCGACTACTCCGACACCAAA...

Protein

Download Protein FASTA

333 aa · TkA04G433160|TK1151|PROTEIN

MMVAAVSETTNRNQTRPPLLPAEKDNGISAPNKSIRPKPRQVTSRYLSPSPSTSSHSYSNSNSSSLPTLRRSPSPLISRNSTTPTPKRSVSADRRRPTRPDLTLKPSNAGGGACEASGLSAATKLLVTSTRSLSVSFQGEAFSLPISKTKVTPQSPNVRKGTPERKRTTTPLRTKVDSGGGGGDHIDNAKLMDQHRWPGRIRQANTTVLSKRLSLECGTEKNDNVIRASHQSSLDFDTGIDLLNHFQRNPDGNLFKDSDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G433160`
TK1151 ID	TkA04G433160
OH-1004 ID	LXL04_038475
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 97.297 / OH-1004 54.899 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G433160

Location Chr04:109217476-109224348 (+)

Description Similar to QWRF2: QWRF motif-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49890`	QWRF motif-containing protein 2.	No verified direct reference in this release
`At3g19570`	Probable microtubule-associated peroxisomal protein required for chloroplast biogenesis and for the formation of the prolamellar body and prothylakoids in etioplasts.	No verified direct reference in this release
`At4g30710`	Contributes to the assembly of the acentrosomal spindle and phragmoplast microtubule arrays as part of the augmin complex.	Characterization of the Arabidopsis augmin complex uncovers its critical function in the assembly of the acentrosomal spindle and phragmoplast microtubule arrays.2012 · DOI: 10.1105/tpc.112.096610
`At2g24070`	QWRF motif-containing protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038475 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005880 nuclear microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G49890

ath:AT2G24070

ath:AT3G19570

ath:AT4G30710

ath:AT5G43160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · TkA04G433160 · TK1151

Nucleus0.416

Rank 2 · TkA04G433160 · TK1151

Cell membrane0.149

Rank 3 · TkA04G433160 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA04G433160 · TK1151

Plastid0.019

Rank 5 · TkA04G433160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04484QWRF29-107 aa

PF12444Sox_N50-85 aa

PF12444Sox_N161-210 aa

PF12444Sox_N258-272 aa

PF04484QWRF262-314 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G433160	`PF04484`	QWRF	29	107	0.015	15.7
TkA04G433160	`PF12444`	Sox_N	50	85	3.4	9.5
TkA04G433160	`PF12444`	Sox_N	161	210	3.4	9.5
TkA04G433160	`PF12444`	Sox_N	258	272	3.4	9.5
TkA04G433160	`PF04484`	QWRF	262	314	0.015	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AI1`	Arabidopsis thaliana	sp\|Q94AI1\|QWRF2_ARATH QWRF motif-containing protein 2	39.700%	Swiss-Prot	Medium
`Q8GXD9`	Arabidopsis thaliana	sp\|Q8GXD9\|SCO3_ARATH Protein SNOWY COTYLEDON 3	39.700%	Swiss-Prot	Medium
`Q9SUH5`	Arabidopsis thaliana	sp\|Q9SUH5\|AUG8_ARATH AUGMIN subunit 8	29.600%	Swiss-Prot	Low
`F4INP9`	Arabidopsis thaliana	sp\|F4INP9\|QWRF4_ARATH QWRF motif-containing protein 4	32.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card