TkA04G432980 | RubberDandelionOmics

Gene overview

TkA04G432980

Reference: TK1151 Chr: Chr04 Coordinates: 109166836-109167231 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA04G432980|TK1151|cDNA

ATGCGCGTTTCCCTTCTTGGCGATGCCTCGCGTCGCTTTTCCAACGCCGAGGAACGCGGCGTTCCTCCTTTCCTTCGCTGCTCCAACGGCTATTTCACAGTCCAACGGTACAATTCATCAAACGAGTTCTTCCTTTTCTTCTTCTATATAAACCTTCATACTACATTTAAAATTCTTGCTCAATTCTTTTCTATGCTACAATCTAGCCGCCAAACAAAGGGTCGCAAGGGAAAGACTAAAACCGCTCAAGAAAAAGTTGT...

CDS

Download CDS FASTA

396 bp · TkA04G432980|TK1151|CDS

ATGCGCGTTTCCCTTCTTGGCGATGCCTCGCGTCGCTTTTCCAACGCCGAGGAACGCGGCGTTCCTCCTTTCCTTCGCTGCTCCAACGGCTATTTCACAGTCCAACGGTACAATTCATCAAACGAGTTCTTCCTTTTCTTCTTCTATATAAACCTTCATACTACATTTAAAATTCTTGCTCAATTCTTTTCTATGCTACAATCTAGCCGCCAAACAAAGGGTCGCAAGGGAAAGACTAAAACCGCTCAAGAAAAAGTTGT...

Protein

Download Protein FASTA

131 aa · TkA04G432980|TK1151|PROTEIN

MRVSLLGDASRRFSNAEERGVPPFLRCSNGYFTVQRYNSSNEFFLFFFYINLHTTFKILAQFFSMLQSSRQTKGRKGKTKTAQEKVVPYTPEELVCLADAWCLTSKDSIKGNDNKKNGYWEAIRKLFHTLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G432980`
TK1151 ID	TkA04G432980
OH-1004 ID	LXL04_035394
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.300
Protein coverage (%)	TK1151 51.908 / OH-1004 18.942 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G432980`
Location	Chr04:109166836-109167231 (-)
Description	Similar to GIF3: GRF1-interacting factor 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035394` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0008283 cell population proliferation Biological Process GO:0008284 positive regulation of cell population proliferation Biological Process GO:0010582 floral meristem determinacy Biological Process GO:0040029 epigenetic regulation of gene expression Biological Process GO:0045596 negative regulation of cell differentiation Biological Process GO:0045787 positive regulation of cell cycle Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048316 seed development Biological Process
KEGG gene cross-reference	ath:AT1G01160 ath:AT4G00850 dosa:Os03g0733600 hsa:6760 zma:100101544 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.736

Rank 1 · TkA04G432980 · TK1151

Cytoplasm0.281

Rank 2 · TkA04G432980 · TK1151

Mitochondrion0.043

Rank 3 · TkA04G432980 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA04G432980 · TK1151

Cell membrane0.035

Rank 5 · TkA04G432980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13613HTH_Tnp_440-68 aa

PF12333Ipi1_N50-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G432980	`PF13613`	HTH_Tnp_4	40	68	0.063	13.6
TkA04G432980	`PF12333`	Ipi1_N	50	82	0.2	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card