TkA04G432930 | RubberDandelionOmics

Gene overview

TkA04G432930

Reference: TK1151 Chr: Chr04 Coordinates: 109155715-109156790 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

845 bp · TkA04G432930|TK1151|cDNA

GTGGCACAATCCGATAGCATGAAAAGAAAAACACGTCTAGGGCACACCATAAGCCCCCAACAATGGCTATGCCTTTAGGGTTTTTCTCCACTTTTTCTGCCGCCGGACCGTCGTCACTCACCAAGTCACCGTCATCGTCGTTGACGTTTGTTCACCCGGCGGCGTTTAAACCATACAACGTTACACTTCGGACACTAGTCACATACGCCACGGCCTCAGAGCCTGCAACCGACACGAAGAAGCGAGCACCTAGAGGCTTC...

CDS

Download CDS FASTA

444 bp · TkA04G432930|TK1151|CDS

ATGGCTATGCCTTTAGGGTTTTTCTCCACTTTTTCTGCCGCCGGACCGTCGTCACTCACCAAGTCACCGTCATCGTCGTTGACGTTTGTTCACCCGGCGGCGTTTAAACCATACAACGTTACACTTCGGACACTAGTCACATACGCCACGGCCTCAGAGCCTGCAACCGACACGAAGAAGCGAGCACCTAGAGGCTTCTCGAAGCCGCGTCCGGTGTCGCCGGAAATGAAGGATTTCCTTGGCGGTAGAAATGAAATCCC...

Protein

Download Protein FASTA

147 aa · TkA04G432930|TK1151|PROTEIN

MAMPLGFFSTFSAAGPSSLTKSPSSSLTFVHPAAFKPYNVTLRTLVTYATASEPATDTKKRAPRGFSKPRPVSPEMKDFLGGRNEIPRTEVLKVIWAYIKEKDLQDPANKRVIKCDEKLKKIFGEREQVGFLEIAGLISPHFLKAES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G432930`
TK1151 ID	TkA04G432930
OH-1004 ID	LXL04_005972
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.500
Protein coverage (%)	TK1151 67.347 / OH-1004 80.342 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G432930`
Location	Chr04:109155715-109156790 (+)
Description	Similar to UAF30: Upstream activation factor subunit UAF30 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005972` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0006361 transcription initiation at RNA polymerase I promoter Biological Process GO:0042790 nucleolar large rRNA transcription by RNA polymerase I Biological Process GO:0045943 positive regulation of transcription by RNA polymerase I Biological Process GO:0000500 RNA polymerase I upstream activating factor complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0001165 RNA polymerase I cis-regulatory region sequence-specific DNA binding Molecular Function GO:0001181 RNA polymerase I general transcription initiation factor activity Molecular Function GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	sce:YMR233W sce:YOR295W spo:2539310 vg:4156281 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.935

Rank 1 · TkA04G432930 · TK1151

Mitochondrion0.057

Rank 2 · TkA04G432930 · TK1151

Nucleus0.039

Rank 3 · TkA04G432930 · TK1151

Cytoplasm0.015

Rank 4 · TkA04G432930 · TK1151

Cell membrane0.006

Rank 5 · TkA04G432930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02201SWIB68-142 aa

PF26291SWIB_eIF2D88-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G432930	`PF02201`	SWIB	68	142	1.9e-28	98.8
TkA04G432930	`PF26291`	SWIB_eIF2D	88	127	5.5e-06	26.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card