TkA04G431480 | RubberDandelionOmics

Gene overview

TkA04G431480

Reference: TK1151 Chr: Chr04 Coordinates: 108830681-108833429 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · TkA04G431480|TK1151|cDNA

TTACATTTTACGATACCTTCTCTCATATCTAAAAAGGCACTTGTTTTGCTATCTGTACTTTCACAGTCAAAATCCCACTCTCCATCTCCTGAACGTCCCAGTACTCCAGTCGGTGGCGTGGTCTAAAAAATGCCACAAAACGAGGCTGCGTCGATTGACCCACTCGCCGGAGGAAGCTTTTCCCGGCTCCTCTTTTCCGACGTAGGAGTCGAAGACGCCGTCAATATTCTGGGTCTTGATGATCACCACCGCTGCCACTA...

CDS

Download CDS FASTA

840 bp · TkA04G431480|TK1151|CDS

ATGCCACAAAACGAGGCTGCGTCGATTGACCCACTCGCCGGAGGAAGCTTTTCCCGGCTCCTCTTTTCCGACGTAGGAGTCGAAGACGCCGTCAATATTCTGGGTCTTGATGATCACCACCGCTGCCACTACCCTGATAATACAAACGGCGGCGGTGCCAGCCATTTCGCATTTAGTTCCGATCGAAAGCCACCGAAAATGCTGTGCTTTGGCTCAGATTATATCAGCAGTAACATCAATGGCGTCTCTGGGGTTTCATC...

Protein

Download Protein FASTA

279 aa · TkA04G431480|TK1151|PROTEIN

MPQNEAASIDPLAGGSFSRLLFSDVGVEDAVNILGLDDHHRCHYPDNTNGGGASHFAFSSDRKPPKMLCFGSDYISSNINGVSGVSSTPQNSTTTTADDNYNSSSPSSTTTTTSFSSTSNMKRNMRCNFYQPIELPSSVATTAATTAPVRNGKKMRAEKTPPASHAKVKKEKLGERIAALQQIVSPYGKTDTASVLHEAMGYIKFLQDQVQVLCSPYLQRPPSIHIEGKEEGEQRMRKDLRSRGLCMVPVECTLQVAESN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G431480`
TK1151 ID	TkA04G431480
OH-1004 ID	LXL04_038457
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G431480

Location Chr04:108830681-108833429 (-)

Description Similar to BHLH113: Transcription factor bHLH113

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19500`	Transcription factor bHLH113.	No verified direct reference in this release
`At2g31730`	Transcription factor bHLH154.	No verified direct reference in this release
`At1g05710`	Transcription factor bHLH153.	No verified direct reference in this release
`At4g29100`	Transcription factor bHLH68.	No verified direct reference in this release
`At1g27660`	Transcription factor bHLH110.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0005634 nucleus Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G05710

ath:AT1G27660

ath:AT2G31730

ath:AT3G19500

ath:AT4G29100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · TkA04G431480 · TK1151

Cytoplasm0.069

Rank 2 · TkA04G431480 · TK1151

Cell membrane0.023

Rank 3 · TkA04G431480 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA04G431480 · TK1151

Plastid0.010

Rank 5 · TkA04G431480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04281Tom22102-110 aa

PF12602FinO_N145-178 aa

PF04281Tom22163-204 aa

PF23177bHLH_IRO3163-213 aa

PF23173bHLH_SAC51166-209 aa

PF00010HLH174-207 aa

PF27761VUP_C239-250 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G431480	`PF04281`	Tom22	102	110	0.0023	18.5
TkA04G431480	`PF12602`	FinO_N	145	178	0.14	12.9
TkA04G431480	`PF04281`	Tom22	163	204	0.0023	18.5
TkA04G431480	`PF23177`	bHLH_IRO3	163	213	0.0051	17.9
TkA04G431480	`PF23173`	bHLH_SAC51	166	209	0.0073	16.9
TkA04G431480	`PF00010`	HLH	174	207	0.032	14.7
TkA04G431480	`PF27761`	VUP_C	239	250	0.0083	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT67`	Arabidopsis thaliana	sp\|Q9LT67\|BH113_ARATH Transcription factor bHLH113	64.100%	Swiss-Prot	Low
`Q7XJU1`	Arabidopsis thaliana	sp\|Q7XJU1\|BH154_ARATH Transcription factor bHLH154	57.700%	Swiss-Prot	Low
`Q7XJU2`	Arabidopsis thaliana	sp\|Q7XJU2\|BH153_ARATH Transcription factor bHLH153	61.800%	Swiss-Prot	Low
`Q8S3D1`	Arabidopsis thaliana	sp\|Q8S3D1\|BH068_ARATH Transcription factor bHLH68	44.200%	Swiss-Prot	Low
`Q9SFZ3`	Arabidopsis thaliana	sp\|Q9SFZ3\|BH110_ARATH Transcription factor bHLH110	51.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card