TkA04G427370 | RubberDandelionOmics

Gene overview

TkA04G427370

Reference: TK1151 Chr: Chr04 Coordinates: 107853141-107855460 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1699 bp · TkA04G427370|TK1151|cDNA

ACAATATATCTTGTAGACTCCCATCGACTGAAAAACAGTGTGTATAAATATAAAGAAAGGACAAGCGTGACAACCGCTCTGATACTATCACTTCCTTTTCTTTTCTGTTTTTTTCTGCAACCTTCTCTCTATCTCTCTCTCCTCCTCTGATTGATACATACAGAGCGCCTAACCTATACGTATAGAGAGAGAGAGAGAGAGAGAGAGACAGAGGGAGAAACAGAGTAAAATTGAAGGACCAATGGATGATTGTATGAGGG...

CDS

Download CDS FASTA

1035 bp · TkA04G427370|TK1151|CDS

ATGAAGAACATGATCATCAATGGAGTCTCGAAGACGATGAAGATGAAGTTCCACAAACCACCCTCACAGATTTCTCCGATCTCCATTTTGCACCCCTGGGCCACCAAGATTTGTTCTGGGAACATGAAGAACTCGTGTCTCTCTTCACAAAAGAACAAGAACAACAAAAAACAACAACCCCCTTGCACTTTCTCTTTCCTCCAAACAGATCCCTCTGTTTTTCTTGCTCGCAAAGAGGCTGTGAATTGGATCCTTAAGGT...

Protein

Download Protein FASTA

344 aa · TkA04G427370|TK1151|PROTEIN

MKNMIINGVSKTMKMKFHKPPSQISPISILHPWATKICSGNMKNSCLSSQKNKNNKKQQPPCTFSFLQTDPSVFLARKEAVNWILKVKAHYGFTPLTAILAINYLDRFLSSLHFQKDKPWMIQLVAVSCLSLAAKVEETQVPLLLDLQVEETKFLFEAKNIQKMELLVMSTLKWRMNPVTPISFLDHIVRRLGLNNHLHWDFFKKCEALVLDLVSDSRFACYKPSVLATASMLHVVDENEIDLPNSIDYKSQLLDLLKTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G427370`
TK1151 ID	TkA04G427370
OH-1004 ID	LXL04_038420
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 83.721 / OH-1004 80.447 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G427370

Location Chr04:107853141-107855460 (+)

Description Similar to CYCD3-1: Cyclin-D3-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34160`	Involved in the control of the cell cycle at the G1/S (start) transition.	Cytokinin activation of Arabidopsis cell division through a D-type cyclin.1999 · DOI: 10.1126/science.283.5407.1541 Ectopic D-type cyclin expression induces not only DNA replication but also cell division in Arabidopsis trichomes.2002 · DOI: 10.1073/pnas.092657299 Altered cell cycle distribution, hyperplasia, and inhibited differentiation in Arabidopsis caused by the D-type cyclin CYCD3.2003 · DOI: 10.1105/tpc.004838 The D-type cyclin CYCD3;1 is limiting for the G1-to-S-phase transition in Arabidopsis.2006 · DOI: 10.1105/tpc.105.039636 Requirement for A-type cyclin-dependent kinase and cyclins for the terminal division in the stomatal lineage of Arabidopsis.2014 · DOI: 10.1093/jxb/eru139
`At5g67260`	Promotes divisions in the guard cells (GCs) after the guard mother cells (GMC) symmetric division when in the presence of CDKA-1.	No verified direct reference in this release
`At3g50070`	Promotes divisions in the guard cells (GCs) after the guard mother cells (GMC) symmetric division.	No verified direct reference in this release
`At2g22490`	Acts on the G1 phase of the cell cycle to control cell division rate in both shoot and root meristems.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0620800`	Cyclin-D2-2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0048316 seed development Biological Process

GO:0051301 cell division Biological Process

GO:1901371 regulation of leaf morphogenesis Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT3G50070

ath:AT4G34160

ath:AT5G67260

dosa:Os07g0620800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA04G427370 · TK1151

Cytoplasm0.096

Rank 2 · TkA04G427370 · TK1151

Cell membrane0.021

Rank 3 · TkA04G427370 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA04G427370 · TK1151

Plastid0.012

Rank 5 · TkA04G427370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134Cyclin_N54-177 aa

PF02984Cyclin_C179-283 aa

PF18349PAZ_4244-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G427370	`PF00134`	Cyclin_N	54	177	9.9e-29	100.3
TkA04G427370	`PF02984`	Cyclin_C	179	283	1.4e-13	51.6
TkA04G427370	`PF18349`	PAZ_4	244	286	0.086	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42753`	Arabidopsis thaliana	sp\|P42753\|CCD31_ARATH Cyclin-D3-1	53.300%	Swiss-Prot	High
`Q9FGQ7`	Arabidopsis thaliana	sp\|Q9FGQ7\|CCD32_ARATH Cyclin-D3-2	55.000%	Swiss-Prot	High
`Q9SN11`	Arabidopsis thaliana	sp\|Q9SN11\|CCD33_ARATH Cyclin-D3-3	52.300%	Swiss-Prot	High
`P42752`	Arabidopsis thaliana	sp\|P42752\|CCD21_ARATH Cyclin-D2-1	40.600%	Swiss-Prot	Medium
`Q8LHA8`	Oryza sativa subsp. japonica	sp\|Q8LHA8\|CCD22_ORYSJ Cyclin-D2-2	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card