TkA04G426030 | RubberDandelionOmics

Gene overview

TkA04G426030

Reference: TK1151 Chr: Chr04 Coordinates: 107512358-107512795 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · TkA04G426030|TK1151|cDNA

ATGGCGGCAGCTCCACCAAATTCTGTGCAATGCTTCGGCCGGAAGAAGACGGCGGTGGCCGTTACTCACTGCAAGGCTGGCCGTGGTCTAATCAAAATCAACGGTGTCCCAATCGAGCTTGTTCAGCCCGAAATCCTCCGTTACAAGGCGTTCGAGCCGATCCTTCTTCTTGGCCGACACAAGTTCGCCGGCGTCGACATGAGGATCCGCGTTAAAGGTGGAGGTCACACTTCCCAGATCTACGCAATCCGTCAGAGCAT...

CDS

Download CDS FASTA

438 bp · TkA04G426030|TK1151|CDS

ATGGCGGCAGCTCCACCAAATTCTGTGCAATGCTTCGGCCGGAAGAAGACGGCGGTGGCCGTTACTCACTGCAAGGCTGGCCGTGGTCTAATCAAAATCAACGGTGTCCCAATCGAGCTTGTTCAGCCCGAAATCCTCCGTTACAAGGCGTTCGAGCCGATCCTTCTTCTTGGCCGACACAAGTTCGCCGGCGTCGACATGAGGATCCGCGTTAAAGGTGGAGGTCACACTTCCCAGATCTACGCAATCCGTCAGAGCAT...

Protein

Download Protein FASTA

145 aa · TkA04G426030|TK1151|PROTEIN

MAAAPPNSVQCFGRKKTAVAVTHCKAGRGLIKINGVPIELVQPEILRYKAFEPILLLGRHKFAGVDMRIRVKGGGHTSQIYAIRQSIAKALVAYYQKFVDEEQKKEIKDILIRYDRTLLVADPRRCEPKKFGGRGARSRFQKSYR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G426030`
TK1151 ID	TkA04G426030
OH-1004 ID	LXL04_038414
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G426030

Location Chr04:107512358-107512795 (+)

Description Similar to RPS16: 40S ribosomal protein S16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g09990`	Small ribosomal subunit protein uS9z.	No verified direct reference in this release
`At5g18380`	Small ribosomal subunit protein uS9x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006412 translation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G09990

ath:AT5G18380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.892

Rank 1 · TkA04G426030 · TK1151

Nucleus0.263

Rank 2 · TkA04G426030 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA04G426030 · TK1151

Mitochondrion0.032

Rank 4 · TkA04G426030 · TK1151

Cell membrane0.019

Rank 5 · TkA04G426030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00380Ribosomal_S913-145 aa

PF09735Nckap141-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G426030	`PF00380`	Ribosomal_S9	13	145	4.8e-38	131.1
TkA04G426030	`PF09735`	Nckap1	41	101	0.36	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK22`	Arabidopsis thaliana	sp\|Q9SK22\|RS161_ARATH Small ribosomal subunit protein uS9z	87.700%	Swiss-Prot	High
`Q42340`	Arabidopsis thaliana	sp\|Q42340\|RS163_ARATH Small ribosomal subunit protein uS9x	87.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card