TkA04G423800 | RubberDandelionOmics

Gene overview

TkA04G423800

Reference: TK1151 Chr: Chr04 Coordinates: 106842081-106845997 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1828 bp · TkA04G423800|TK1151|cDNA

CGACAATTCTTTAGGGACCGCAGGGGATCACGGCTGGGTTGGTTTACTTTCTCTCTTTACCAGCTGCTTTGTCTAATATGTAGACAAACTCTACATTCACACAAATGCAATAAAAATATACAGCTAAACCATAGTTGTTAAAGTAGACAGGAGAAAAAGAAAAAAACCTTTAAAAAAAGAACGAAAATAAAAACACGAAAAACACAAAACAAAAACTTGAAGAAGCAAAGTCATAAGACATGGATTCCAACAAGCAAACC...

CDS

Download CDS FASTA

1041 bp · TkA04G423800|TK1151|CDS

ATGGATTCCAACAAGCAAACCTTCGAGGAACAAGATTCAGAGATGAATCAAAATCTGACATCTGACAAGTCGAAGAAGAGGAAGCGGACTCCTAAAGAGACTTGTGAAGCTAAATCCAAAGATAAACAGATTGCATCAGATAAACCCAAGAAAGCTTCTGGTAAAGGAAAAAGAACAAAAGTTTGTAACATTTATAATGATGCGGAAGATCAATATATGTGTATGGAACGAGCGGCTTTTTTATTGGAGCGTTTGGATGA...

Protein

Download Protein FASTA

346 aa · TkA04G423800|TK1151|PROTEIN

MDSNKQTFEEQDSEMNQNLTSDKSKKRKRTPKETCEAKSKDKQIASDKPKKASGKGKRTKVCNIYNDAEDQYMCMERAAFLLERLDEDSPKFAKCMLPSNVLYSFWLILPKKFCVKHLPDNDTTVILVDESGKEFKTNYLKIRHGLSAGWRGFSIAQRLLQGDILFFHLVEPCKLQVNIVRRYGLEAIEAAVSLMEMHPRVKKTRTSNYFDKAAESKKEKLKHKEVKEEQEDKAINNQIIVPVHTIKGKRTRRSPKKFIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G423800`
TK1151 ID	TkA04G423800
OH-1004 ID	LXL04_038385
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G423800

Location Chr04:106842081-106845997 (+)

Description Similar to Os06g0194400: B3 domain-containing protein Os06g0194400

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0194400`	B3 domain-containing protein Os06g0194400.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038385 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os01g0234100

dosa:Os03g0184500

dosa:Os05g0481400

dosa:Os06g0194400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA04G423800 · TK1151

Cytoplasm0.084

Rank 2 · TkA04G423800 · TK1151

Cell membrane0.019

Rank 3 · TkA04G423800 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkA04G423800 · TK1151

Mitochondrion0.008

Rank 5 · TkA04G423800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13299CPSF100_C18-42 aa

PF02362B320-45 aa

PF02362B392-182 aa

PF13299CPSF100_C174-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G423800	`PF13299`	CPSF100_C	18	42	4.3	8.2
TkA04G423800	`PF02362`	B3	20	45	1.4e-15	57.7
TkA04G423800	`PF02362`	B3	92	182	1.4e-15	57.7
TkA04G423800	`PF13299`	CPSF100_C	174	264	4.3	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q69V36`	Oryza sativa subsp. japonica	sp\|Q69V36\|Y6944_ORYSJ B3 domain-containing protein Os06g0194400	46.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card