TkA04G423370 | RubberDandelionOmics

Gene overview

TkA04G423370

Reference: TK1151 Chr: Chr04 Coordinates: 106721384-106723671 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1693 bp · TkA04G423370|TK1151|cDNA

TTACAAGAGGTTAAATTAATGGGCAGGAGAGTCGGTGTCGGAGGATAAAATATGTGACAAGTCGAGATATCAAAAAAAGAATCTTTAAAATTTTCCATTCTCTCTCCTTCCATTTCACAATCTCTAGATTCTCTTTACAGAATTTCTTTGAAATTTTCTCCAAGATATCATCCAAACAAGCATATACACCTCCACACGCTAATCACCACTCTCCACCATTTCTCTTTATGTCCAAATTCTGATCTATCAACAACAAATTG...

CDS

Download CDS FASTA

933 bp · TkA04G423370|TK1151|CDS

ATGGGAAGCTTAAATCCATATCCTGAGCTAAGTTTCGATTTCCGACCATGTTTTATCCCCAAAACAATCGGCCAGTTTCTTGGAGAAGTGTCGAGGATCAATAACGTAACCGCTAAGGTTTCGCAAGTTGATGATTTTGTTAACCACTTGGAAATCGAAACGCGGAAAATTGAAGCAGTCAAAGGAGAATTCCCTCTTTGCATGCTTCTTATCAACGATGCAATCGATGTGTTGAAGAACGAATCAATGAAGTTGAAGAA...

Protein

Download Protein FASTA

310 aa · TkA04G423370|TK1151|PROTEIN

MGSLNPYPELSFDFRPCFIPKTIGQFLGEVSRINNVTAKVSQVDDFVNHLEIETRKIEAVKGEFPLCMLLINDAIDVLKNESMKLKKTSNPEPVLEEFIPMKNNCNDDSKVEITASQKDAGDKRNWLSSTHLWNANENADQKAISVKENSSERTEEEDAVKLCLITEINGVNGGLGCRPPPQKQTTTRKQRRCWSTELHRRFLSALQDLGGSQAATPKQIRDLMQVDGLTNDEVKSHLQKYRIHTRRHPSSNTNQIMGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G423370`
TK1151 ID	TkA04G423370
OH-1004 ID	LXL04_038360
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G423370

Location Chr04:106721384-106723671 (-)

Description Similar to HHO5: Transcription factor HHO5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13300`	Transcription factor involved in nitrate and phosphate signaling in roots.	Overexpressing HRS1 confers hypersensitivity to low phosphate-elicited inhibition of primary root growth in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1744-7909.2009.00819.x HRS1 acts as a negative regulator of abscisic acid signaling to promote timely germination of Arabidopsis seeds.2012 · DOI: 10.1371/journal.pone.0035764 AtNIGT1/HRS1 integrates nitrate and phosphate signals at the Arabidopsis root tip.2015 · DOI: 10.1038/ncomms7274
`At2g03500`	Transcription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature.	No verified direct reference in this release
`At4g37180`	Transcriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower.	No verified direct reference in this release
`At1g49560`	Probable transcription factor involved in phosphate signaling in roots.	No verified direct reference in this release
`At3g25790`	Probable factor involved in nitrate and phosphate signaling in roots.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038360 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032107 regulation of response to nutrient levels Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048449 floral organ formation Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G13300

ath:AT1G25550

ath:AT1G49560

ath:AT2G03500

ath:AT4G37180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA04G423370 · TK1151

Cytoplasm0.089

Rank 2 · TkA04G423370 · TK1151

Cell membrane0.024

Rank 3 · TkA04G423370 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA04G423370 · TK1151

Plastid0.011

Rank 5 · TkA04G423370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26575HHO5_N13-83 aa

PF09331DUF1985104-170 aa

PF09331DUF1985174-234 aa

PF00249Myb_DNA-binding191-242 aa

PF26575HHO5_N216-236 aa

PF08593Mug135_C220-251 aa

PF15895CAAX_1240-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G423370	`PF26575`	HHO5_N	13	83	1.2e-23	83.6
TkA04G423370	`PF09331`	DUF1985	104	170	0.2	12.4
TkA04G423370	`PF09331`	DUF1985	174	234	0.2	12.4
TkA04G423370	`PF00249`	Myb_DNA-binding	191	242	2.7e-06	28.1
TkA04G423370	`PF26575`	HHO5_N	216	236	1.2e-23	83.6
TkA04G423370	`PF08593`	Mug135_C	220	251	0.2	12.7
TkA04G423370	`PF15895`	CAAX_1	240	294	0.035	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX67`	Arabidopsis thaliana	sp\|Q9FX67\|HRS1_ARATH Transcription factor HRS1	38.000%	Swiss-Prot	Medium
`Q9ZQ85`	Arabidopsis thaliana	sp\|Q9ZQ85\|EFM_ARATH Myb family transcription factor EFM	35.400%	Swiss-Prot	Medium
`F4JRB0`	Arabidopsis thaliana	sp\|F4JRB0\|HHO5_ARATH Transcription factor HHO5	35.700%	Swiss-Prot	Medium
`Q9FX84`	Arabidopsis thaliana	sp\|Q9FX84\|HHO6_ARATH Transcription factor HHO6	36.100%	Swiss-Prot	Medium
`Q9LS00`	Arabidopsis thaliana	sp\|Q9LS00\|HHO1_ARATH Transcription factor HHO1	34.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card