TkA04G422610 | RubberDandelionOmics

Gene overview

TkA04G422610

Reference: TK1151 Chr: Chr04 Coordinates: 106521949-106522383 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA04G422610|TK1151|cDNA

ATGGCAATCCGAATCGGGTCGGAAAGTCCGAGATTGGGTATAAACCTACGGGGTATTATTCTGCTCCACCCGTATTTTTGGATGCCGTTCATGGAGGAGATGTGGACCTTTGCCCACCCGGGAACAAGTGGGTTGGATGATCCGATTATTAACCCGGATAAGGATCCGAAAGTGCCGGATCTTGGATGCTCCCGGGTACTGGTTTGTGTTGGTGAGAAGGATATATTGAAGGATAGGGGATGGTATTATAAGGATATTTT...

CDS

Download CDS FASTA

396 bp · TkA04G422610|TK1151|CDS

ATGGCAATCCGAATCGGGTCGGAAAGTCCGAGATTGGGTATAAACCTACGGGGTATTATTCTGCTCCACCCGTATTTTTGGATGCCGTTCATGGAGGAGATGTGGACCTTTGCCCACCCGGGAACAAGTGGGTTGGATGATCCGATTATTAACCCGGATAAGGATCCGAAAGTGCCGGATCTTGGATGCTCCCGGGTACTGGTTTGTGTTGGTGAGAAGGATATATTGAAGGATAGGGGATGGTATTATAAGGATATTTT...

Protein

Download Protein FASTA

131 aa · TkA04G422610|TK1151|PROTEIN

MAIRIGSESPRLGINLRGIILLHPYFWMPFMEEMWTFAHPGTSGLDDPIINPDKDPKVPDLGCSRVLVCVGEKDILKDRGWYYKDILGKNGWAGDIEVIEDKGMDHVFFLFHPSSDTAGTLRKRICTFINN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G422610`
TK1151 ID	TkA04G422610
OH-1004 ID	LXL04_038381
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.200
Protein coverage (%)	TK1151 100.000 / OH-1004 46.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G422610`
Location	Chr04:106521949-106522383 (+)
Description	Similar to CXE2: Probable carboxylesterase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038381` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009717 isoflavonoid biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0046287 isoflavonoid metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0033987 2-hydroxyisoflavanone dehydratase activity Molecular Function GO:0106435 carboxylesterase activity Molecular Function
KEGG gene cross-reference	ath:AT1G47480 ath:AT2G03550 ath:AT3G48690 ath:AT3G48700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.840

Rank 1 · TkA04G422610 · TK1151

Nucleus0.367

Rank 2 · TkA04G422610 · TK1151

Endoplasmic reticulum0.056

Rank 3 · TkA04G422610 · TK1151

Cell membrane0.033

Rank 4 · TkA04G422610 · TK1151

Mitochondrion0.027

Rank 5 · TkA04G422610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07859Abhydrolase_329-109 aa

PF20219DUF657999-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G422610	`PF07859`	Abhydrolase_3	29	109	6.6e-10	39.8
TkA04G422610	`PF20219`	DUF6579	99	125	0.22	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card