TkA04G415970 | RubberDandelionOmics

Gene overview

TkA04G415970

Reference: TK1151 Chr: Chr04 Coordinates: 104765175-104772971 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2353 bp · TkA04G415970|TK1151|cDNA

TCACCACCACGGTGGTTTCCGGTTGGGGTCCACCATATCTAGATGGAGAGCAGGAGATGCCACAACTGCAACGCTGAATAAAGTAACCATAAACAAGTAGATATCACACGTTAGCGCGCTTTCTCTCTCACACACACAAACTGAAATTCAACTTTGATCCGAAGCATTAATGGAGCTTCGGTCAATTCAGTCTCCGGTCGTTAGTAGCATACCTGCAAAAGGCTTTAAGGAATCGCAGCAATTCATATGCTACCGCAACC...

CDS

Download CDS FASTA

2505 bp · TkA04G415970|TK1151|CDS

ATGGAGCTTCGGTCAATTCAGTCTCCGGTCGTTAGTAGCATACCTGCAAAAGGCTTTAAGGAATCGCAGCAATTCATATGCTACCGCAACCTTATCAAATCCTTCGGAACGAAGTCAATAGCTCAGACAAATGCTATAAAGCTTAGACCAGTTCGATTCAAGGTCCAAGCCTCAGTTTATGCTTTGACTTTCAACTTTCAAGTAATCGGTTTCGATGTTTCATTCATGATTAGTGAGAATTTCGCGAGCAATTTCAATTG...

Protein

Download Protein FASTA

834 aa · TkA04G415970|TK1151|PROTEIN

MELRSIQSPVVSSIPAKGFKESQQFICYRNLIKSFGTKSIAQTNAIKLRPVRFKVQASVYALTFNFQVIGFDVSFMISENFASNFNCATTTGTQPAESETKDGEEVVFVAGATGKVGSRTVRELLKLKFNVRAGVRSIQRAQSLVKSVQQMKLDGSQPIEKLELVECDLEKPEQIKSALGKASTVICCIGASEKEIFDVTGPYRIDFQATKNLIDAAAAAKAKHFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAEEAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G415970`
TK1151 ID	TkA04G415970
OH-1004 ID	LXL04_038309
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.300
Protein coverage (%)	TK1151 71.343 / OH-1004 91.493 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G415970

Location Chr04:104765175-104772971 (+)

Description Similar to TIC62: Protein TIC 62, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18890`	Involved in protein precursor import into chloroplasts.	No verified direct reference in this release
`At2g37660`	Uncharacterized protein At2g37660, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0100300`	Involved in protein precursor import into chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038309 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component

KEGG gene cross-reference

ath:AT3G18890

dosa:Os10g0100300

osa:4347935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · TkA04G415970 · TK1151

Cytoplasm0.027

Rank 2 · TkA04G415970 · TK1151

Mitochondrion0.027

Rank 3 · TkA04G415970 · TK1151

Cell membrane0.023

Rank 4 · TkA04G415970 · TK1151

Nucleus0.017

Rank 5 · TkA04G415970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA105-282 aa

PF00106adh_short106-182 aa

PF01370Epimerase107-230 aa

PF02719Polysacc_synt_2107-229 aa

PF16363GDP_Man_Dehyd108-184 aa

PF010733Beta_HSD109-231 aa

PF07993NAD_binding_4109-230 aa

PF13460NAD_binding_10111-317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G415970	`PF05368`	NmrA	105	282	1.7e-15	58.1
TkA04G415970	`PF00106`	adh_short	106	182	0.0072	16.5
TkA04G415970	`PF01370`	Epimerase	107	230	6.4e-08	33.0
TkA04G415970	`PF02719`	Polysacc_synt_2	107	229	0.061	13.2
TkA04G415970	`PF16363`	GDP_Man_Dehyd	108	184	0.0063	16.7
TkA04G415970	`PF01073`	3Beta_HSD	109	231	9.5e-07	28.8
TkA04G415970	`PF07993`	NAD_binding_4	109	230	0.0015	18.4
TkA04G415970	`PF13460`	NAD_binding_10	111	317	2.9e-32	112.7
TkA04G415970	`PF08732`	HIM1	174	275	0.0006	20.1
TkA04G415970	`PF07993`	NAD_binding_4	262	275	0.0015	18.4
TkA04G415970	`PF01370`	Epimerase	623	637	6.4e-08	33.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H0U5`	Arabidopsis thaliana	sp\|Q8H0U5\|TIC62_ARATH Protein TIC 62, chloroplastic	50.000%	Swiss-Prot	High
`O80934`	Arabidopsis thaliana	sp\|O80934\|Y2766_ARATH Uncharacterized protein At2g37660, chloroplastic	42.200%	Swiss-Prot	Low
`Q10A77`	Oryza sativa subsp. japonica	sp\|Q10A77\|TIC62_ORYSJ Protein TIC 62, chloroplastic	50.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card