TkA04G410420 | RubberDandelionOmics

Gene overview

TkA04G410420

Reference: TK1151 Chr: Chr04 Coordinates: 103356085-103357801 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA04G410420|TK1151|cDNA

ATAAACTAAAAAATAAAAATATTAAAAATCATCGGTTAATTAAGATAGTAAGAAAAGCACGGCAGCCGTCACAAGCCTGAGGTGACGGTTCTATCGCCCATCTGAGAAAAATCGACCATCTTCTTTTACACAACTCTCCTTTTCCAATTTATCTAATCGACTATCTTCCCCCGATTCTCCCTCATTGGAGGGTTCTGAGTTCGCATAACTTTCAATGGAAGGTGTTGAAGGCGCTAATACTGCATCTGCAGCCACTTTGG...

CDS

Download CDS FASTA

468 bp · TkA04G410420|TK1151|CDS

ATGGATAGGAACAGCTACTTTAGCACTTCTCTTTACACTCCGTGTTTATTATGTTCAAGGGTTCTACATTGTTGCATATGGACTCGGAATCTACATACTCAATCTACTAATCGGGTTTTTATCCCTTTGGTTGACCCTGAAGTGGACCCCACAGACAGTGCTATCCTACCTACAAAAGGGTCAGATGAGTTCAAGCCTTTTATCCGACGTCTCCCTGAATTCAAATTCTGGTATGCCATCACCAAGGCTTTCATTATATC...

Protein

Download Protein FASTA

155 aa · TkA04G410420|TK1151|PROTEIN

MDRNSYFSTSLYTPCLLCSRVLHCCIWTRNLHTQSTNRVFIPLVDPEVDPTDSAILPTKGSDEFKPFIRRLPEFKFWYAITKAFIISIMMTFFSMFDVPVFWPILLCYWFVLFAMTMKRQIMHMIKYKYIPFSIGKQKYGGKKSSTGGSSDRSRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G410420`
TK1151 ID	TkA04G410420
OH-1004 ID	LXL04_038261
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.548 / OH-1004 58.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G410420

Location Chr04:103356085-103357801 (-)

Description Similar to RER1A: Protein RER1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21600`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At4g39220`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At2g23310`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At2g18240`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038261 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006621 protein retention in ER lumen Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0035437 maintenance of protein localization in endoplasmic reticulum Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G18240

ath:AT2G21600

ath:AT2G23310

ath:AT4G39220

bta:100125922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.434

Rank 1 · TkA04G410420 · TK1151

Nucleus0.190

Rank 2 · TkA04G410420 · TK1151

Mitochondrion0.146

Rank 3 · TkA04G410420 · TK1151

Cytoplasm0.133

Rank 4 · TkA04G410420 · TK1151

Golgi apparatus0.132

Rank 5 · TkA04G410420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05210Sprouty9-29 aa

PF03248Rer140-139 aa

PF05210Sprouty91-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G410420	`PF05210`	Sprouty	9	29	1.2	10.2
TkA04G410420	`PF03248`	Rer1	40	139	2.8e-46	158.1
TkA04G410420	`PF05210`	Sprouty	91	117	1.2	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48671`	Arabidopsis thaliana	sp\|O48671\|RER1B_ARATH Protein RER1B	78.800%	Swiss-Prot	Medium
`O48670`	Arabidopsis thaliana	sp\|O48670\|RER1A_ARATH Protein RER1A	77.100%	Swiss-Prot	Medium
`Q9ZWI7`	Arabidopsis thaliana	sp\|Q9ZWI7\|RER1C_ARATH Protein RER1C	62.900%	Swiss-Prot	Medium
`Q9ZPV7`	Arabidopsis thaliana	sp\|Q9ZPV7\|RER1D_ARATH Protein RER1D	65.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card