RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G408490
Reference: TK1151 Chr: Chr04 Coordinates: 102690575-102705139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2763 bp · TkA04G408490|TK1151|cDNA

ACCTGGTAGGATCAAAACCCGCACGAATGGCCAATCGGAGCTCATTGCCGCTAACCAAAACAGCCCCGCAACCTAAACTCCTCAAATGTTGTAAAATCGGGAAATTGTTATTGGCTTTGATTGCATATCCGATAACCGAATTCAATCCCTCCAAAGCATCCTTGTAAGCCTCGACATTTCTGGTTATTTGAGGTTTACTGTAAAGATAAAAGGGCCTTTTTTCGACGGCTTCCATGACTTCTTTAACCTTGAGATTCTCG...

CDS

Download CDS FASTA

1656 bp · TkA04G408490|TK1151|CDS

ATGAGTGCCGGAATGTCTGGACCTATTGTCGGTTTACAAAAAACCGACATTGAATACTCTGAGGAAAAGAAATATAAGCTTTCCTTCAAGCAAAGGGCAATAATTGCCTCCAACAAATTAAGGACTTCATTCGGGAGGAAAAGCAGGAAGAATGGGAAACCGGTGTCTGTTGTTGAACATGTTCATGATGCAGATGAACTAAAAATAGTCGATGCTTTTCGCCAAGCTTTGATCTTGGAAGAATTACTACCCACAAAACA...

Protein

Download Protein FASTA

551 aa · TkA04G408490|TK1151|PROTEIN

MSAGMSGPIVGLQKTDIEYSEEKKYKLSFKQRAIIASNKLRTSFGRKSRKNGKPVSVVEHVHDADELKIVDAFRQALILEELLPTKHDDYHMMLRFLKARKFDIEKTKQMWADMIRWRKDYGTDTIIEDFDFAEKEEVGKYYPQGYHGVDKEGRPVYIEQLGKVDATKLLQVTTLERYVKYHVKEFERTFVDKFPACSIAAKRHIDQSTTILDVQGVGLKNMNKNARELIQCLQNIDGNNYPETLCRMYIVNAGSGFRLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G408490
TK1151 IDTkA04G408490
OH-1004 IDLXL04_038239
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)95.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G408490
LocationChr04:102690575-102705139 (-)
DescriptionSimilar to SFH3: Phosphatidylinositol/phosphatidylcholine transfer protein SFH3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g21540 Required for transport of secretory proteins from the Golgi complex (By similarity).
Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
At4g36490 Required for transport of secretory proteins from the Golgi complex (By similarity).
Identification of two phosphatidylinositol/phosphatidylcholine transfer protein genes that are predominately transcribed in the flowers of Arabidopsis thaliana.2007 · DOI: 10.1016/j.jplph.2006.03.014
At2g18180 Required for transport of secretory proteins from the Golgi complex. No verified direct reference in this release
At4g34580 Required for transport of secretory proteins from the Golgi complex (By similarity).
The Arabidopsis COW1 gene encodes a phosphatidylinositol transfer protein essential for root hair tip growth.2004 · DOI: 10.1111/j.1365-313x.2004.02245.x
OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice.2013 · DOI: 10.1007/s11103-013-0033-4
The COW1 locus of arabidopsis acts after RHD2, and in parallel with RHD3 and TIP1, to determine the shape, rate of elongation, and number of root hairs produced from each site of hair formation.1997 · DOI: 10.1104/pp.115.3.981
At4g39180 Required for transport of secretory proteins from the Golgi complex (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038239 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006656 phosphatidylcholine biosynthetic process Biological Process
GO:0006892 post-Golgi vesicle-mediated transport Biological Process
GO:0009908 flower development Biological Process
GO:0009932 cell tip growth Biological Process
GO:0010053 root epidermal cell differentiation Biological Process
GO:0015031 protein transport Biological Process
GO:0048767 root hair elongation Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005794 Golgi apparatus Cellular Component
KEGG gene cross-reference
ath:AT2G18180
ath:AT2G21540
ath:AT4G34580
ath:AT4G36490
ath:AT4G39180
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.305
Rank 1 · TkA04G408490 · TK1151
Endoplasmic reticulum0.276
Rank 2 · TkA04G408490 · TK1151
Cytoplasm0.222
Rank 3 · TkA04G408490 · TK1151
Golgi apparatus0.186
Rank 4 · TkA04G408490 · TK1151
Nucleus0.100
Rank 5 · TkA04G408490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12410rpo30_N14-39 aa
PF16740SKA236-61 aa
PF03846SulA49-78 aa
PF28528UBA_Pinta70-118 aa
PF03765CRAL_TRIO_N87-113 aa
PF12410rpo30_N119-139 aa
PF00650CRAL_TRIO140-302 aa
PF13716CRAL_TRIO_2214-304 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G408490PF12410rpo30_N14390.07413.7
TkA04G408490PF16740SKA236610.3111.6
TkA04G408490PF03846SulA49780.1413.1
TkA04G408490PF28528UBA_Pinta701180.0002521.9
TkA04G408490PF03765CRAL_TRIO_N871139.1e-0626.5
TkA04G408490PF12410rpo30_N1191390.07413.7
TkA04G408490PF00650CRAL_TRIO1403024.6e-31108.4
TkA04G408490PF13716CRAL_TRIO_22143041.9e-0629.0
TkA04G408490PF10046BLOC1_22192360.7710.9
TkA04G408490PF03846SulA3874440.1413.1
TkA04G408490PF12410rpo30_N3914270.07413.7
TkA04G408490PF10157BORCS64294890.2512.3
TkA04G408490PF10046BLOC1_24695280.7710.9
TkA04G408490PF16740SKA24725380.3111.6
TkA04G408490PF03961FapA4735390.6510.3
TkA04G408490PF05335DUF7454855270.2311.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93ZE9Arabidopsis thalianasp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH358.200%Swiss-ProtHigh
Q94A34Arabidopsis thalianasp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1257.400%Swiss-ProtHigh
Q9SI13Arabidopsis thalianasp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1056.500%Swiss-ProtHigh
F4JLE5Arabidopsis thalianasp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH155.600%Swiss-ProtHigh
F4JVA9Arabidopsis thalianasp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH255.100%Swiss-ProtHigh

JBrowse

View in Genome Browser