TkA04G399260 | RubberDandelionOmics

Gene overview

TkA04G399260

Reference: TK1151 Chr: Chr04 Coordinates: 100423281-100426349 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1716 bp · TkA04G399260|TK1151|cDNA

TTGAACGAATCATGATAACAGCTAACGTGCGCACGTGCCCCCAAATTTATCCTACTTTCTGTCCGATTCTGTCTGAAGAAAAATTGATAACTCAAGCCACCGCAGCGACGCCGCACAGTCGGCGCTGCCGCTTTCGCCCCTTCTACAAACTCCATTTCGATCTTCAATCTCCAAACCAAAGCTCTTCCATCAATCTACCATCCACCTGCATTTCACTCACAGAAACAACTTCCGCATTCAATTTCAACGTTCCTATCAGT...

CDS

Download CDS FASTA

1143 bp · TkA04G399260|TK1151|CDS

ATGACGGGGAAGAAGAGAGTTTCTGTTGTTGCTTCGAGACGCCACATTCTGCCGCTTGTTTCGAAGTTTGTGATCACATTGTTGGTACTGTGTTGCTTCGTCGTCTTTTTCGGACTCTTCTCGCAATTCAGACTCCAGTCGTCGTCTGTATCTACTGAATTCGGTTTCGACGAGTTCCGCCTCGAAGATTATCGTATGAAGATCGCTTTCCTTTTCCTCGTTCGAGACAACCTTCCTCTTGATTTCCTTTGGCACAACTT...

Protein

Download Protein FASTA

380 aa · TkA04G399260|TK1151|PROTEIN

MTGKKRVSVVASRRHILPLVSKFVITLLVLCCFVVFFGLFSQFRLQSSSVSTEFGFDEFRLEDYRMKIAFLFLVRDNLPLDFLWHNFFKNADPENFTIYIHSKPGFVFDKSATRSAFFYNRQLKNSVEVGWGKPTMIEAEKLLFKSALEDTNNQIFILLSDSCVPLYNFSYIYKYIMSSPRSYVDSFIDEDGTEKRYNPEMSPDIPEDKWRKGSQWITLVRRHAEVVAYDHVVFPIFNKHCKRRPLLDLSKGNESLKEQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G399260`
TK1151 ID	TkA04G399260
OH-1004 ID	LXL04_038151
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 79.665 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G399260

Location Chr04:100423281-100426349 (+)

Description Similar to BC10: Glycosyltransferase BC10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0170000`	Glycosyltransferase required for the regulation of cellulose biosynthesis in the cell wall.	BC10, a DUF266-containing and Golgi-located type II membrane protein, is required for cell-wall biosynthesis in rice (Oryza sativa L.).2009 · DOI: 10.1111/j.1365-313x.2008.03703.x A Novel FC116/BC10 Mutation Distinctively Causes Alteration in the Expression of the Genes for Cell Wall Polymer Synthesis in Rice.2016 · DOI: 10.3389/fpls.2016.01366

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038151 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009664 plant-type cell wall organization Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

dosa:Os05g0170000

osa:4337935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.773

Rank 1 · TkA04G399260 · TK1151

Endoplasmic reticulum0.079

Rank 2 · TkA04G399260 · TK1151

Cell membrane0.065

Rank 3 · TkA04G399260 · TK1151

Cytoplasm0.062

Rank 4 · TkA04G399260 · TK1151

Lysosome / Vacuole0.043

Rank 5 · TkA04G399260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02485Branch68-324 aa

PF04060FeS340-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G399260	`PF02485`	Branch	68	324	8.4e-68	229.3
TkA04G399260	`PF04060`	FeS	340	357	0.38	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q65XS5`	Oryza sativa subsp. japonica	sp\|Q65XS5\|BC10_ORYSJ Glycosyltransferase BC10	49.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card