TkA04G387930 | RubberDandelionOmics

Gene overview

TkA04G387930

Reference: TK1151 Chr: Chr04 Coordinates: 97597373-97599143 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · TkA04G387930|TK1151|cDNA

AATTGTTACATGAAGGATAGTGATGCTAATTTGATGTTTAATTTGTTGGAAAATCGAGCGGATAGCATTCCTGGTTTCTCTTTCTATAATTTGTTAGAAGATTCTGAATTAAGGGGTGTTTTTTGGGCTGATTCAATAGCAAAGAGGAACTACAAAGAGTTTTCTGATGTTATTTCTTTTGATGCTACCTATAGGACCAACAAGTACAATTTGGTTTTTGTCCATTTTACGGGAATTGATAACCATCAAAGGTGTGTTAC...

CDS

Download CDS FASTA

1266 bp · TkA04G387930|TK1151|CDS

ATGAAGGATAGTGATGCTAATTTGATGTTTAATTTGTTGGAAAATCGAGCGGATAGCATTCCTGGTTTCTCTTTCTATAATTTGTTAGAAGATTCTGAATTAAGGGGTGTTTTTTGGGCTGATTCAATAGCAAAGAGGAACTACAAAGAGTTTTCTGATGTTATTTCTTTTGATGCTACCTATAGGACCAACAAGTACAATTTGGTTTTTGTCCATTTTACGGGAATTGATAACCATCAAAGGTGTGTTACATTTGGAGC...

Protein

Download Protein FASTA

421 aa · TkA04G387930|TK1151|PROTEIN

MKDSDANLMFNLLENRADSIPGFSFYNLLEDSELRGVFWADSIAKRNYKEFSDVISFDATYRTNKYNLVFVHFTGIDNHQRCVTFGAALMAQETEEYYIWLLESFLNAFGKQPNVVVTDQDAAVGNAVQKVFTQSKHRLCMWHIGNKLTVYVSAEVIKESNFIKRMQNLIWNPCLDPHLFEDKWNSLVAEHKLEDNPWLKRMYSLRSRWIPAYFKDTPLSGLMRTTSRSESENYVFQSFMSNTTNLVMFICKFDAAMDKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G387930`
TK1151 ID	TkA04G387930
OH-1004 ID	LXL04_038090
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 85.748 / OH-1004 49.049 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G387930

Location Chr04:97597373-97599143 (-)

Description Similar to FRS5: Protein FAR1-RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G76320

ath:AT2G27110

ath:AT3G22170

ath:AT4G15090

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.599

Rank 1 · TkA04G387930 · TK1151

Cytoplasm0.438

Rank 2 · TkA04G387930 · TK1151

Mitochondrion0.053

Rank 3 · TkA04G387930 · TK1151

Cell membrane0.034

Rank 4 · TkA04G387930 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA04G387930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056ZSWIM1-3_RNaseH-like30-135 aa

PF10551MULE54-145 aa

PF00872Transposase_mut82-154 aa

PF21056ZSWIM1-3_RNaseH-like211-246 aa

PF10551MULE249-249 aa

PF21056ZSWIM1-3_RNaseH-like316-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G387930	`PF21056`	ZSWIM1-3_RNaseH-like	30	135	5.3e-09	36.8
TkA04G387930	`PF10551`	MULE	54	145	1.6e-27	96.4
TkA04G387930	`PF00872`	Transposase_mut	82	154	0.0096	15.6
TkA04G387930	`PF21056`	ZSWIM1-3_RNaseH-like	211	246	5.3e-09	36.8
TkA04G387930	`PF10551`	MULE	249	249	1.6e-27	96.4
TkA04G387930	`PF21056`	ZSWIM1-3_RNaseH-like	316	339	5.3e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	sp\|Q9SZL8\|FRS5_ARATH Protein FAR1-RELATED SEQUENCE 5	33.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card