TkA04G387020 | RubberDandelionOmics

Gene overview

TkA04G387020

Reference: TK1151 Chr: Chr04 Coordinates: 97374548-97379533 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1196 bp · TkA04G387020|TK1151|cDNA

CCCCAATCCGCTTTCTTCCTATATAAATGCATCTGTGCTCTCACTCATTTCTAAGCATTCTTCACTCGCAATTTCTAGAGATGGGGGATTTCGTTGTTTTCGCTATCTTCTTCATGCAAATCTTCTACATCACCGGAGCCAAGGTTCCGGCGGTGATTGTGTTCGGCGACTCCTCTGTAGATGCTGGAAACAACAATCAAATCGATACTGTTTTGCGGAGCAATTTCCGCCCTTACGGGCGTGATTTTTTTGGAGGAAAA...

CDS

Download CDS FASTA

1104 bp · TkA04G387020|TK1151|CDS

ATGCATCTGTGCTCTCACTCATTTCTAAGCATTCTTCACTCGCAATTTCTAGAGATGGGGGATTTCGTTGTTTTCGCTATCTTCTTCATGCAAATCTTCTACATCACCGGAGCCAAGGTTCCGGCGGTGATTGTGTTCGGCGACTCCTCTGTAGATGCTGGAAACAACAATCAAATCGATACTGTTTTGCGGAGCAATTTCCGCCCTTACGGGCGTGATTTTTTTGGAGGAAAAGCTACCGGAAGATTCTCCAATGGCCG...

Protein

Download Protein FASTA

367 aa · TkA04G387020|TK1151|PROTEIN

MHLCSHSFLSILHSQFLEMGDFVVFAIFFMQIFYITGAKVPAVIVFGDSSVDAGNNNQIDTVLRSNFRPYGRDFFGGKATGRFSNGRVPPDFISEAFGLRPFVPAFLDPAYNISDFATGVCFASAGTGYDNATSAVLSVIPLWREVEYYKEYQTKLRSYLGDEKANTVISEAVYLISMGTNDFLENYYTLPDRKSQYNVTQYQDYLVSIAELFVKELYALGARKVSLGGLPPMGCLPLERTTSFFAGNQDTCKDEYNKVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G387020`
TK1151 ID	TkA04G387020
OH-1004 ID	LXL04_038077
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G387020

Location Chr04:97374548-97379533 (+)

Description Similar to At4g26790: GDSL esterase/lipase At4g26790

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26790`	GDSL esterase/lipase At4g26790.	No verified direct reference in this release
`At2g42990`	GDSL esterase/lipase At2g42990.	No verified direct reference in this release
`At2g04570`	GDSL esterase/lipase At2g04570.	No verified direct reference in this release
`At1g06990`	GDSL esterase/lipase At1g06990.	No verified direct reference in this release
`At2g31550`	GDSL esterase/lipase At2g31550.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038077 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

GO:0016298 lipase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT1G06990

ath:AT2G04570

ath:AT2G42990

ath:AT3G14820

ath:AT4G26790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.455

Rank 1 · TkA04G387020 · TK1151

Lysosome / Vacuole0.220

Rank 2 · TkA04G387020 · TK1151

Cytoplasm0.119

Rank 3 · TkA04G387020 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA04G387020 · TK1151

Cell membrane0.078

Rank 5 · TkA04G387020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL43-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G387020	`PF00657`	Lipase_GDSL	43	356	2e-28	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY93`	Arabidopsis thaliana	sp\|Q8VY93\|GDL66_ARATH GDSL esterase/lipase At4g26790	66.600%	Swiss-Prot	High
`Q67ZI9`	Arabidopsis thaliana	sp\|Q67ZI9\|GDL48_ARATH GDSL esterase/lipase At2g42990	63.700%	Swiss-Prot	High
`Q9SJB4`	Arabidopsis thaliana	sp\|Q9SJB4\|GDL34_ARATH GDSL esterase/lipase At2g04570	64.000%	Swiss-Prot	High
`Q9LMJ3`	Arabidopsis thaliana	sp\|Q9LMJ3\|GDL1_ARATH GDSL esterase/lipase At1g06990	40.800%	Swiss-Prot	Medium
`Q9SIQ2`	Arabidopsis thaliana	sp\|Q9SIQ2\|GDL44_ARATH GDSL esterase/lipase At2g31550	40.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card