TkA04G375540 | RubberDandelionOmics

Gene overview

TkA04G375540

Reference: TK1151 Chr: Chr04 Coordinates: 94630663-94636201 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · TkA04G375540|TK1151|cDNA

ATGGAGAAGTTCAAAGACCCTATTCCGGTTAGACCTTCTATCACTAGCGACAGATTCCTCAAACTCAATAATGCGGACAGATGCTTTCTGGAATTACCTTTCCATCCCGAGGAAATAAAGGCTGCAGTGTGGTTATGTGGATCTGAAAAAGTCCCGGATCCAGACGGTTTTAACTTCAGATTCTTTAAACAATTGTGGGATATTATAGGGAAAGACATGGTCGAAGCTGTTCAGTTTTTCGGAGATCATAAAACTTTAAA...

CDS

Download CDS FASTA

1287 bp · TkA04G375540|TK1151|CDS

ATGGAGAAGTTCAAAGACCCTATTCCGGTTAGACCTTCTATCACTAGCGACAGATTCCTCAAACTCAATAATGCGGACAGATGCTTTCTGGAATTACCTTTCCATCCCGAGGAAATAAAGGCTGCAGTGTGGTTATGTGGATCTGAAAAAGTCCCGGATCCAGACGGTTTTAACTTCAGATTCTTTAAACAATTGTGGGATATTATAGGGAAAGACATGGTCGAAGCTGTTCAGTTTTTCGGAGATCATAAAACTTTAAA...

Protein

Download Protein FASTA

428 aa · TkA04G375540|TK1151|PROTEIN

MEKFKDPIPVRPSITSDRFLKLNNADRCFLELPFHPEEIKAAVWLCGSEKVPDPDGFNFRFFKQLWDIIGKDMVEAVQFFGDHKTLNGGCNSSFITLVPKVANPLNLSDFRPINLIGCITKIISKTLAERLKTVIGKVIGKEQTSFIRGRSITDGPLIVSEVISLAKRSQKRVLLFKTDFEKAFDTLNWNFLDSCMSQMGFGEVWRSWIHAIISSAKVSVLVNGTPSHEFNLERGIRQGDPLYPFLFIIAAEGLRIMMDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G375540`
TK1151 ID	TkA04G375540
OH-1004 ID	LXL04_000694
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.000
Protein coverage (%)	TK1151 95.794 / OH-1004 20.697 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G375540

Location Chr04:94630663-94636201 (-)

Description Similar to LBD13: LOB domain-containing protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

KEGG gene cross-reference

ath:AT2G30130

ath:AT2G30340

ath:AT2G40470

ath:AT3G27650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA04G375540 · TK1151

Nucleus0.337

Rank 2 · TkA04G375540 · TK1151

Plastid0.059

Rank 3 · TkA04G375540 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA04G375540 · TK1151

Cell membrane0.053

Rank 5 · TkA04G375540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_1107-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G375540	`PF00078`	RVT_1	107	356	4.8e-26	92.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	35.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card