RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G369260
Reference: TK1151 Chr: Chr04 Coordinates: 92820614-92833574 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4409 bp · TkA04G369260|TK1151|cDNA

ATTAAAAGTGAGATAAGAGTTGATGACAATATGTAGACCCTAGAAAACCAAGTAACTGACCGTACATTTATAAAAGAAAAAGTAACATAGAAGATATTTTCTTTATAGATTGCACCATAGTCTAAGAACTTCGCCAAACCCTGCCACAAAGGGAAAACGAAATTTATGTTAAACAAAGAAGGTCGGTCTAAAATTCACGTGATTAGCTGATCCCCAACCTTGCAAAACTTCAATAAGTCACTTCATGGTCCCACCACTCT...

CDS

Download CDS FASTA

3468 bp · TkA04G369260|TK1151|CDS

ATGTCATCAAGATCGACTAGCAGGACCCATTGTTCCAGGAGCAGTTCATCAAGATTGAAACGCGATGCTCGAGTGATCTCACAAACCCCAATTGACGCAAAGCTTCATGGAGATTTCGAAGACTCCGAACGACAATTTGACTACTCTACTTCCGTCGACGTCAACGCATCAACGTCAACCAGCAATGTCCCGTCATCGACTGTATCAGCGTACCTTCAAAAAATGCAAAGAGGAACTCTAATCCAGCCTTTCGGTTGCAT...

Protein

Download Protein FASTA

1155 aa · TkA04G369260|TK1151|PROTEIN

MSSRSTSRTHCSRSSSSRLKRDARVISQTPIDAKLHGDFEDSERQFDYSTSVDVNASTSTSNVPSSTVSAYLQKMQRGTLIQPFGCMIAIDEQTLTVLAYSENALEMLDLAPHAVPNIEQQEALTFGTDVRTLFRSSSASALQKAVNFPEINLLNPILVHCRSSGKPFYAILHRNDVGLIIDLEPVNPADVPVTAAGALKSYKLAAKAISRLQSLQSGNITRMCDVLVREVSELTGYDRVMVYKFHEDEHGEVIAECRKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G369260
TK1151 IDTkA04G369260
OH-1004 IDLXL04_037978
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.300
Protein coverage (%)TK1151 99.567 / OH-1004 99.075
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G369260
LocationChr04:92820614-92833574 (-)
DescriptionSimilar to PHYC: Phytochrome C
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g35840 Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0752100 Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. No verified direct reference in this release
UniProt: A2XM23 Regulatory photoreceptor which exists in two forms that are reversibly interconvertible by light: the Pr form that absorbs maximally in the red region of the spectrum and the Pfr form that absorbs maximally in the far-red region. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037978 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009584 detection of visible light Biological Process
GO:0009585 red, far-red light phototransduction Biological Process
GO:0009637 response to blue light Biological Process
GO:0017006 protein-tetrapyrrole linkage Biological Process
GO:0005634 nucleus Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0000155 phosphorelay sensor kinase activity Molecular Function
GO:0009881 photoreceptor activity Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference
ath:AT5G35840
dosa:Os03g0752100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.366
Rank 1 · TkA04G369260 · TK1151
Nucleus0.248
Rank 2 · TkA04G369260 · TK1151
Cell membrane0.185
Rank 3 · TkA04G369260 · TK1151
Endoplasmic reticulum0.125
Rank 4 · TkA04G369260 · TK1151
Golgi apparatus0.111
Rank 5 · TkA04G369260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08446PAS_270-186 aa
PF13188PAS_885-111 aa
PF13426PAS_987-121 aa
PF01590GAF221-411 aa
PF23016RsmI_C228-244 aa
PF09026CENP-B_dimeris347-372 aa
PF00360PHY425-599 aa
PF09026CENP-B_dimeris599-628 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G369260PF08446PAS_2701861.8e-37129.0
TkA04G369260PF13188PAS_8851113.5e-0730.6
TkA04G369260PF13426PAS_9871211.6e-0525.8
TkA04G369260PF01590GAF2214114.1e-1660.4
TkA04G369260PF23016RsmI_C2282440.3111.7
TkA04G369260PF09026CENP-B_dimeris3473720.8210.9
TkA04G369260PF00360PHY4255999.9e-57192.0
TkA04G369260PF09026CENP-B_dimeris5996280.8210.9
TkA04G369260PF00989PAS6407533.1e-33114.9
TkA04G369260PF13188PAS_86436823.5e-0730.6
TkA04G369260PF08448PAS_46477577.8e-0730.0
TkA04G369260PF13426PAS_96507161.6e-0525.8
TkA04G369260PF23016RsmI_C6696750.3111.7
TkA04G369260PF00989PAS7708923.1e-33114.9
TkA04G369260PF13188PAS_87848353.5e-0730.6
TkA04G369260PF08448PAS_47848237.8e-0730.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P14714Arabidopsis thalianasp|P14714|PHYC_ARATH Phytochrome C59.000%Swiss-ProtHigh
Q10CQ8Oryza sativa subsp. japonicasp|Q10CQ8|PHYC_ORYSJ Phytochrome C63.500%Swiss-ProtHigh
A2XM23Oryza sativa subsp. indicasp|A2XM23|PHYC_ORYSI Phytochrome C63.500%Swiss-ProtHigh

JBrowse

View in Genome Browser