TkA04G365360 | RubberDandelionOmics

Gene overview

TkA04G365360

Reference: TK1151 Chr: Chr04 Coordinates: 91825168-91828459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2974 bp · TkA04G365360|TK1151|cDNA

TTTAATTATGAGTTTGTATGTTCTACTTATGCATTAATTTCTTGAAGATTTTTTAGATACATATATGAAAATATGACTTTCAAAAGTCAAAGATGAAACGGAAGCCTTTATTACAATTACAAGGGCGTCAAATAGCAATCCTTAGGGGTTCAAGGGTGAATGTGAACATCTTCCGATAGACATAAATAACAAATAACAACTTGGATCCTACAAGACAGAGAAGAAACTGAAGAAATAGAAGGCTAAAAAAATTGCAGCCA...

CDS

Download CDS FASTA

2448 bp · TkA04G365360|TK1151|CDS

ATGGCGATCCAATCTCTTAATTTAATCCCCAATCATATCCCAATAAATACCCATCTTAGTCCGCCTTCTATGTCATCAGTCACGATTTTCTCTTCTCTACAATCTAAAATAAGATTCAGTTCTTCTCGAAATCGAAGAGCATTCATCTCGTCTTTTAATCAGAACAGAGAATCCGTGTTGGATTTTACCGAAAAAGGTGATAAAAGAGATCAAGAACAAGCGTCAATGACGATTGGTCCGGTTGTTCAGCTTTCACGGCG...

Protein

Download Protein FASTA

815 aa · TkA04G365360|TK1151|PROTEIN

MAIQSLNLIPNHIPINTHLSPPSMSSVTIFSSLQSKIRFSSSRNRRAFISSFNQNRESVLDFTEKGDKRDQEQASMTIGPVVQLSRRRLVAKDRTILTDVSEAVSITSASESGQTDGVFLGTIFEQEGSHHVVSLGKLRDVRFMACFRFKLWWMAQKMGSKGSEIPSETQFLLMETVGETETEPIYVVFLPLIEGSFRASLQGNSGDELELSIESGDLDTKSAVFTRTVYVGVGTDPFSTITDAITTVKLHLNSFKQRQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G365360`
TK1151 ID	TkA04G365360
OH-1004 ID	LXL04_002727
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G365360

Location Chr04:91825168-91828459 (-)

Description Similar to RFS6: Probable galactinol--sucrose galactosyltransferase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20250`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At3g57520`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At1g55740`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release
`At5g40390`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0170000`	Transglycosidase operating by a ping-pong reaction mechanism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002727 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0034484 raffinose catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

GO:0047274 galactinol-sucrose galactosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55740

ath:AT3G57520

ath:AT5G20250

ath:AT5G40390

dosa:Os01g0170000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.811

Rank 1 · TkA04G365360 · TK1151

Cytoplasm0.139

Rank 2 · TkA04G365360 · TK1151

Peroxisome0.069

Rank 3 · TkA04G365360 · TK1151

Nucleus0.056

Rank 4 · TkA04G365360 · TK1151

Mitochondrion0.054

Rank 5 · TkA04G365360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05691Raffinose_syn83-798 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G365360	`PF05691`	Raffinose_syn	83	798		1044.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RX87`	Arabidopsis thaliana	sp\|Q8RX87\|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6	66.100%	Swiss-Prot	High
`Q94A08`	Arabidopsis thaliana	sp\|Q94A08\|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2	55.400%	Swiss-Prot	High
`Q84VX0`	Arabidopsis thaliana	sp\|Q84VX0\|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1	53.900%	Swiss-Prot	High
`Q9FND9`	Arabidopsis thaliana	sp\|Q9FND9\|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5	39.700%	Swiss-Prot	Medium
`Q5VQG4`	Oryza sativa subsp. japonica	sp\|Q5VQG4\|RFS_ORYSJ Galactinol--sucrose galactosyltransferase	39.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card