TkA04G362320 | RubberDandelionOmics

Gene overview

TkA04G362320

Reference: TK1151 Chr: Chr04 Coordinates: 91202736-91210396 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4130 bp · TkA04G362320|TK1151|cDNA

ACATCCACAAACAACTACAGTAATAAACCTTTCTTTCATGGCCACATACGTGAAGCACGTTAACTTGTTGCAAACCATCTCCCTTTTACACTTTTTGTTCACACTCACCTGCATTGGGTCATCATGGTCACCACGAAGCCCTGATGAGGAATGCTTAGCCTTGTTTCAGTTTAAGCAAAGCATGATTCATCAAGATGATGAAGCACTATGTGCTCCTAGTTGGTTACAAACGTTCCACTCTTGGAATCTCGCTAGCAATG...

CDS

Download CDS FASTA

2892 bp · TkA04G362320|TK1151|CDS

ATGGCCACATACGTGAAGCACGTTAACTTGTTGCAAACCATCTCCCTTTTACACTTTTTGTTCACACTCACCTGCATTGGGTCATCATGGTCACCACGAAGCCCTGATGAGGAATGCTTAGCCTTGTTTCAGTTTAAGCAAAGCATGATTCATCAAGATGATGAAGCACTATGTGCTCCTAGTTGGTTACAAACGTTCCACTCTTGGAATCTCGCTAGCAATGCATCAGATGTTGCTTTTGATTGTTGTTCATGGTATGG...

Protein

Download Protein FASTA

963 aa · TkA04G362320|TK1151|PROTEIN

MATYVKHVNLLQTISLLHFLFTLTCIGSSWSPRSPDEECLALFQFKQSMIHQDDEALCAPSWLQTFHSWNLASNASDVAFDCCSWYGVECSNDDAYTHVIGLDLSESFLCGHINSTSTLFTLVYLQSLNLAMNDFHDSEIPSGIVHLKQLRSLNLSNSGFIGQIPKEISQLMHLSSLDMTWNPLKLHSPNLDNLVQNLTRLEELHLSGVDISSSMPRFLANFSVLRSIKLADCSLWNELPVSIFKLPKLKILDVSSNANL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G362320`
TK1151 ID	TkA04G362320
OH-1004 ID	LXL04_037946
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G362320

Location Chr04:91202736-91210396 (-)

Description Similar to RLP7: Receptor-like protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At4g13810`	Receptor-like protein 47.	No verified direct reference in this release
`At2g33060`	Receptor like protein 27.	No verified direct reference in this release
`At4g13900`	Receptor-like protein 49.	No verified direct reference in this release
`At5g40170`	Receptor-like protein 54.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037946 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT3G11010

ath:AT3G11080

ath:AT5G27060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.856

Rank 1 · TkA04G362320 · TK1151

Endoplasmic reticulum0.098

Rank 2 · TkA04G362320 · TK1151

Cytoplasm0.060

Rank 3 · TkA04G362320 · TK1151

Nucleus0.051

Rank 4 · TkA04G362320 · TK1151

Lysosome / Vacuole0.022

Rank 5 · TkA04G362320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598LRR_1410-71 aa

PF08263LRRNT_236-91 aa

PF13516LRR_664-74 aa

PF13855LRR_8102-134 aa

PF23598LRR_14111-259 aa

PF27089PRAME_C117-219 aa

PF29594LRR_SKP2121-302 aa

PF24758LRR_At5g56370123-238 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G362320	`PF23598`	LRR_14	10	71	1.4e-30	106.9
TkA04G362320	`PF08263`	LRRNT_2	36	91	0.003	18.5
TkA04G362320	`PF13516`	LRR_6	64	74	3.5	8.6
TkA04G362320	`PF13855`	LRR_8	102	134	1.8e-40	137.2
TkA04G362320	`PF23598`	LRR_14	111	259	1.4e-30	106.9
TkA04G362320	`PF27089`	PRAME_C	117	219	0.31	10.8
TkA04G362320	`PF29594`	LRR_SKP2	121	302	0.14	12.1
TkA04G362320	`PF24758`	LRR_At5g56370	123	238	0.00048	20.6
TkA04G362320	`PF25013`	LRR_Zer-1	124	158	1.2e-10	42.4
TkA04G362320	`PF23211`	LRR_LRWD1	124	208	7.4e-06	26.5
TkA04G362320	`PF13516`	LRR_6	124	137	3.5	8.6
TkA04G362320	`PF00560`	LRR_1	125	146	1.8e-43	137.8
TkA04G362320	`PF13855`	LRR_8	125	184	1.8e-40	137.2
TkA04G362320	`PF12799`	LRR_4	125	164	1e-27	96.2
TkA04G362320	`PF25019`	LRR_R13L1-DRL21	129	179	1e-12	48.8
TkA04G362320	`PF14580`	LRR_9	134	204	2.9	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C699`	Arabidopsis thaliana	sp\|Q9C699\|RLP7_ARATH Receptor-like protein 7	38.000%	Swiss-Prot	Medium
`Q9SVN2`	Arabidopsis thaliana	sp\|Q9SVN2\|RLP47_ARATH Receptor-like protein 47	39.600%	Swiss-Prot	Medium
`F4IUU1`	Arabidopsis thaliana	sp\|F4IUU1\|RLP27_ARATH Receptor like protein 27	37.900%	Swiss-Prot	Medium
`Q9SVM3`	Arabidopsis thaliana	sp\|Q9SVM3\|RLP49_ARATH Receptor-like protein 49	39.300%	Swiss-Prot	Medium
`F4KHA2`	Arabidopsis thaliana	sp\|F4KHA2\|RLP54_ARATH Receptor-like protein 54	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card