TkA04G361530 | RubberDandelionOmics

Gene overview

TkA04G361530

Reference: TK1151 Chr: Chr04 Coordinates: 91022490-91023065 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA04G361530|TK1151|cDNA

ATGGAAAACGGAGGTGTGCCACAATCTGCAGCACCAGAGACTCTTTTGAAAGAGGTTATTCATGTTATCAGTTGTGGATATGAAGATAAATCAGATTGGGGAACTGAGATTGGGTGGATTTATGAATCAGTGACAGAAGATATTATTACGGGATTCAAAATGCATGCTCGTGGTTGGCGATCAATTTACTGTATGCCAAATCCGCCAGCCTTCAAAGATTCAGCTCCAATCAATTTATCAGATCGATTGAATCAAGTACT...

CDS

Download CDS FASTA

480 bp · TkA04G361530|TK1151|CDS

ATGGAAAACGGAGGTGTGCCACAATCTGCAGCACCAGAGACTCTTTTGAAAGAGGTTATTCATGTTATCAGTTGTGGATATGAAGATAAATCAGATTGGGGAACTGAGATTGGGTGGATTTATGAATCAGTGACAGAAGATATTATTACGGGATTCAAAATGCATGCTCGTGGTTGGCGATCAATTTACTGTATGCCAAATCCGCCAGCCTTCAAAGATTCAGCTCCAATCAATTTATCAGATCGATTGAATCAAGTACT...

Protein

Download Protein FASTA

159 aa · TkA04G361530|TK1151|PROTEIN

MENGGVPQSAAPETLLKEVIHVISCGYEDKSDWGTEIGWIYESVTEDIITGFKMHARGWRSIYCMPNPPAFKDSAPINLSDRLNQVLRWALGSVEILFSRHCSIWYGYSGRLKWLERFAYIKTTIYPITSIPLVVYCTFDTGNLFQNLIITYLLILSTD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G361530`
TK1151 ID	TkA04G361530
OH-1004 ID	LXL04_010844
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 86.792 / OH-1004 12.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G361530

Location Chr04:91022490-91023065 (+)

Description Similar to CESA3: Cellulose synthase A catalytic subunit 3 [UDP-forming]

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05170`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	The Arabidopsis mutant cev1 has constitutively active jasmonate and ethylene signal pathways and enhanced resistance to pathogens.2001 · DOI: 10.1105/tpc.13.5.1025 Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931 The Arabidopsis mutant cev1 links cell wall signaling to jasmonate and ethylene responses.2002 · DOI: 10.1105/tpc.002022 Reduced cellulose synthesis invokes lignification and defense responses in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01729.x Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104 Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104
`At5g17420`	Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	Multiple cellulose synthase catalytic subunits are required for cellulose synthesis in Arabidopsis.2000 · DOI: 10.1105/tpc.12.12.2529 Structure of cellulose-deficient secondary cell walls from the irx3 mutant of Arabidopsis thaliana.2002 · DOI: 10.1016/s0031-9422(02)00199-1 Impairment of cellulose synthases required for Arabidopsis secondary cell wall formation enhances disease resistance.2007 · DOI: 10.1105/tpc.106.048058

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XN66`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`Os03g0808100`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release
`Os07g0208500`	Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G05170

dosa:Os03g0808100

dosa:Os05g0176100

dosa:Os07g0208500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.598

Rank 1 · TkA04G361530 · TK1151

Golgi apparatus0.203

Rank 2 · TkA04G361530 · TK1151

Cell membrane0.119

Rank 3 · TkA04G361530 · TK1151

Cytoplasm0.119

Rank 4 · TkA04G361530 · TK1151

Nucleus0.091

Rank 5 · TkA04G361530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt1-150 aa

PF13632Glyco_trans_2_336-115 aa

PF13641Glyco_tranf_2_342-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G361530	`PF03552`	Cellulose_synt	1	150	2.1e-77	262.0
TkA04G361530	`PF13632`	Glyco_trans_2_3	36	115	2.9e-07	31.2
TkA04G361530	`PF13641`	Glyco_tranf_2_3	42	90	0.04	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941L0`	Arabidopsis thaliana	sp\|Q941L0\|CESA3_ARATH Cellulose synthase A catalytic subunit 3 [UDP-forming]	84.400%	Swiss-Prot	High
`Q9SWW6`	Arabidopsis thaliana	sp\|Q9SWW6\|CESA7_ARATH Cellulose synthase A catalytic subunit 7 [UDP-forming]	79.000%	Swiss-Prot	High
`A2XN66`	Oryza sativa subsp. indica	sp\|A2XN66\|CESA2_ORYSI Probable cellulose synthase A catalytic subunit 2 [UDP-forming]	88.300%	Swiss-Prot	High
`Q84M43`	Oryza sativa subsp. japonica	sp\|Q84M43\|CESA2_ORYSJ Probable cellulose synthase A catalytic subunit 2 [UDP-forming]	88.300%	Swiss-Prot	High
`Q84ZN6`	Oryza sativa subsp. japonica	sp\|Q84ZN6\|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit 8 [UDP-forming]	86.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card