TkA04G360960 | RubberDandelionOmics

Gene overview

TkA04G360960

Reference: TK1151 Chr: Chr04 Coordinates: 90881916-90885905 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

522 bp · TkA04G360960|TK1151|cDNA

ATGAGCCCTACCCTTGACGTCGGCGATCGAATTATGGCCGAAAAGGTTTCATATATCTTTCGGAATCCAGAAGTTTCTGATATTGTGATCTTCAGGCTCCTCCCATTCTCCAGAGTTTGGAAATTAGGTAAAAGGGTTGTTTCAGGATCGTGGTTGTTGAGAAAGGAGAGAACAGAGTCTGATGTGTTTGGGGATTTGGATAAATCTAGACAACTGGAGGCTAGAATTGCAGATTCGGGAGAAATTCCACATGAATTAAT...

CDS

Download CDS FASTA

522 bp · TkA04G360960|TK1151|CDS

ATGAGCCCTACCCTTGACGTCGGCGATCGAATTATGGCCGAAAAGGTTTCATATATCTTTCGGAATCCAGAAGTTTCTGATATTGTGATCTTCAGGCTCCTCCCATTCTCCAGAGTTTGGAAATTAGGTAAAAGGGTTGTTTCAGGATCGTGGTTGTTGAGAAAGGAGAGAACAGAGTCTGATGTGTTTGGGGATTTGGATAAATCTAGACAACTGGAGGCTAGAATTGCAGATTCGGGAGAAATTCCACATGAATTAAT...

Protein

Download Protein FASTA

173 aa · TkA04G360960|TK1151|PROTEIN

MSPTLDVGDRIMAEKVSYIFRNPEVSDIVIFRLLPFSRVWKLGKRVVSGSWLLRKERTESDVFGDLDKSRQLEARIADSGEIPHELMRKGVGHTEIVTVGPVVEEEENPAAACEWWCHILTVSKVYQKQNQESHSFKLAGGRYLYRREEGPFRLDLCLRQIANVQDAKALEEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G360960`
TK1151 ID	TkA04G360960
OH-1004 ID	LXL04_037933
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	54.100
Protein coverage (%)	TK1151 65.896 / OH-1004 90.654 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G360960

Location Chr04:90881916-90885905 (+)

Description Similar to TPP2: Probable thylakoidal processing peptidase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06870`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release
`At2g30440`	Cleaves the thylakoid-transfer domain from a chloroplast protein.	No verified direct reference in this release
`At3g24590`	Involved in the maturation of the plastid protein translocation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006465 signal peptide processing Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051604 protein maturation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009526 plastid envelope Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G06870

ath:AT2G30440

ath:AT3G24590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.433

Rank 1 · TkA04G360960 · TK1151

Cytoplasm0.209

Rank 2 · TkA04G360960 · TK1151

Nucleus0.148

Rank 3 · TkA04G360960 · TK1151

Plastid0.131

Rank 4 · TkA04G360960 · TK1151

Peroxisome0.064

Rank 5 · TkA04G360960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10502Peptidase_S261-47 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G360960	`PF10502`	Peptidase_S26	1	47	2.1e-05	25.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9Z2`	Arabidopsis thaliana	sp\|Q9M9Z2\|TPP2_ARATH Probable thylakoidal processing peptidase 2, chloroplastic	55.000%	Swiss-Prot	Low
`O04348`	Arabidopsis thaliana	sp\|O04348\|TPP1_ARATH Thylakoidal processing peptidase 1, chloroplastic	77.100%	Swiss-Prot	Low
`Q8H0W1`	Arabidopsis thaliana	sp\|Q8H0W1\|PLSP1_ARATH Chloroplast processing peptidase	65.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card