TkA04G360930 | RubberDandelionOmics

Gene overview

TkA04G360930

Reference: TK1151 Chr: Chr04 Coordinates: 90877819-90878617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

496 bp · TkA04G360930|TK1151|cDNA

ACCACCCATAAATTAACATCTGGAGTATTCTCAATCTTCACACATCTTCTCGAGATCTTCGTACTCTCTAAGCCACTAGATCGGAAACAATCAAACATACACACTCAGTTACAGTCGGATCATCATCTAGTTTACAGAAATGGCGAAGCAAAAGATTGTGGTGAAAATTACAATGCACAACGAAAAGAAAATTCGTAAGGCTCTGAAGATCGCTGTTAGTCTCTCCGGTGTTGAATCGGCGTCATTTGTTGGTTCAGATA...

CDS

Download CDS FASTA

357 bp · TkA04G360930|TK1151|CDS

ATGGCGAAGCAAAAGATTGTGGTGAAAATTACAATGCACAACGAAAAGAAAATTCGTAAGGCTCTGAAGATCGCTGTTAGTCTCTCCGGTGTTGAATCGGCGTCATTTGTTGGTTCAGATAAAACCCAGATCGCTGTGACCGGGGAAGATGTTGACTCGGTGGAACTAGTGATGTTGCTAAGGAAAGGCGTAGGATACACAGAGCTAGTGAGTGTTGGTCCGGTGGAGGAGAAGAAACCTGCCGCCGCCAAAGAAACGAA...

Protein

Download Protein FASTA

119 aa · TkA04G360930|TK1151|PROTEIN

MAKQKIVVKITMHNEKKIRKALKIAVSLSGVESASFVGSDKTQIAVTGEDVDSVELVMLLRKGVGYTELVSVGPVEEKKPAAAKETKPMVAPLYFNPYQLDPFVEGVSYNISVNIFINK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G360930`
TK1151 ID	TkA04G360930
OH-1004 ID	LXL04_037935
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 97.479 / OH-1004 69.461 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G360930

Location Chr04:90877819-90878617 (+)

Description Similar to HIPP16: Heavy metal-associated isoprenylated plant protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48290`	Probable heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037935 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G07600

ath:AT5G48290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA04G360930 · TK1151

Nucleus0.325

Rank 2 · TkA04G360930 · TK1151

Cell membrane0.184

Rank 3 · TkA04G360930 · TK1151

Mitochondrion0.067

Rank 4 · TkA04G360930 · TK1151

Extracellular0.062

Rank 5 · TkA04G360930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23232AAA_lid_139-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G360930	`PF23232`	AAA_lid_13	9	54	0.2	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5PNZ7`	Arabidopsis thaliana	sp\|Q5PNZ7\|HIP46_ARATH Heavy metal-associated isoprenylated plant protein 46	44.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card