TkA04G354030 | RubberDandelionOmics

Gene overview

TkA04G354030

Reference: TK1151 Chr: Chr04 Coordinates: 89306102-89308743 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1278 bp · TkA04G354030|TK1151|cDNA

AACCTTACAAAATACAATGGAGTTCTTCATCAAATAAGCCGAACCATATTGATGCCAGTTAAAAGGGTATGATGTAAAAATCATAAACAAAAATCAGACACATATCAAGTTATCCACATGTTTCATACATCCTGGGCCCTGTGAATATGAGTGGAGTGGATAGAGTCATAGAAGTTGCATTTTACTGATTGAAGAACATTCAGAAAGAGATGATAGTTGCAGGAATTGGATCGATTCCTAAATCAGTCTCCCTTATTCCC...

CDS

Download CDS FASTA

837 bp · TkA04G354030|TK1151|CDS

ATGATAGTTGCAGGAATTGGATCGATTCCTAAATCAGTCTCCCTTATTCCCCATAACAATTTCAGATCCCCAAATTCAATTACAAATCCTGGAAACCGAACTCATTTTCCAGTACGAAAATCAAGCAATTTCTCCCTCCAAAAGTTCATCCCTACCTACCCTCCTTTCTTCTCCTCCATCAAGGCCGCTGCTTCTTCTTCTTCCGAGATTTTCGCAGATTACGCCGAAGAGCCAGCTACAAATGTCAAATTTCCGACATT...

Protein

Download Protein FASTA

278 aa · TkA04G354030|TK1151|PROTEIN

MIVAGIGSIPKSVSLIPHNNFRSPNSITNPGNRTHFPVRKSSNFSLQKFIPTYPPFFSSIKAAASSSSEIFADYAEEPATNVKFPTLLSLPGCSSSLSLIGTGFREKVFAIIGVKVYAAGLYINPKIIEKLPAWKGRTPAQIQDDSSLFDLIYNAPLEKSLQIVLVRDVDGKTFWDALNDAISPRIKSPTAVDETALSDFRGIFQNRPLKKGTFIFLTWLDSSKILIHLSNDGIPSTSEATIEAENVTRSLFDVFFGRDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G354030`
TK1151 ID	TkA04G354030
OH-1004 ID	LXL04_039750
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 69.065 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G354030

Location Chr04:89306102-89308743 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53520`	Fatty-acid-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005504 fatty acid binding Molecular Function

GO:0016872 intramolecular lyase activity Molecular Function

GO:0045430 chalcone isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · TkA04G354030 · TK1151

Mitochondrion0.034

Rank 2 · TkA04G354030 · TK1151

Cytoplasm0.024

Rank 3 · TkA04G354030 · TK1151

Nucleus0.019

Rank 4 · TkA04G354030 · TK1151

Peroxisome0.015

Rank 5 · TkA04G354030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10186ATG1421-90 aa

PF02431Chalcone81-273 aa

PF16036Chalcone_381-125 aa

PF16035Chalcone_297-269 aa

PF16036Chalcone_3151-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G354030	`PF10186`	ATG14	21	90	0.13	12.0
TkA04G354030	`PF02431`	Chalcone	81	273	1.2e-21	77.8
TkA04G354030	`PF16036`	Chalcone_3	81	125	1.8e-12	48.4
TkA04G354030	`PF16035`	Chalcone_2	97	269	4.6e-13	50.2
TkA04G354030	`PF16036`	Chalcone_3	151	268	1.8e-12	48.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8L2`	Arabidopsis thaliana	sp\|Q9C8L2\|FAP3_ARATH Fatty-acid-binding protein 3, chloroplastic	64.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card