RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G352380
Reference: TK1151 Chr: Chr04 Coordinates: 88880240-88882470 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1120 bp · TkA04G352380|TK1151|cDNA

GAAGTCGAGTTGACTGCCACAAGCACGGGCTAGTGGGATGATAAAAAAGTATGAACTCTTTGATTTCGCTTGCTTCTTTTAGCAATCGACGCAAGCAATCCAAAATTCGGATTACATAAGCGAAGATTATCGGAGGAATCTTACGCAGGTAATGATCCAAATAGAAGAAATTTGAGGAGAGAGACGATTAACGAAGAAGAAATTAAGAATTGCAAAATAATAGTTTGAATCCGTCTATCAATGGCTGCTTTGGTTTCGCC...

CDS

Download CDS FASTA

708 bp · TkA04G352380|TK1151|CDS

ATGGCTGCTTTGGTTTCGCCAGAAACGTTCGAGATTTGCAAGCAAGCTGCTGGAATAGCTGGAAACATATTCGCTTTTGGCCTCTTTGTCTCACCCATACCAACATTTCGAAGAATCATCAGAAACCAATCAACAGAACAATTCTCAGGAATCCCATACATATACGCCCTCTTAAACTGCTTAATCTGTGCCTGGTATGGCTGCCCATTCATCTCTTCAGACAACTTACTGGTTACAACAGTTAATTCTGTTGGTGCGGT...

Protein

Download Protein FASTA

235 aa · TkA04G352380|TK1151|PROTEIN

MAALVSPETFEICKQAAGIAGNIFAFGLFVSPIPTFRRIIRNQSTEQFSGIPYIYALLNCLICAWYGCPFISSDNLLVTTVNSVGAVFQLSYIIIYITNTEKPKKFKMSALLVAVFGLFAVIAVGSMLVIDLELRHLLIGFLSCFTLISMFASPLSVMNVVIQTKSVEFMPFYLSLSTFLMSTSFLLYGVFNFDPFIYVPNGIGTILGIAQLALYFYYHDKSKEESREPLIESVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G352380
TK1151 IDTkA04G352380
OH-1004 IDLXL04_037801
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G352380
LocationChr04:88880240-88882470 (+)
DescriptionSimilar to SWEET2: Bidirectional sugar transporter SWEET2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g14770 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2WR31 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Os01g0541800 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
UniProt: B8A833 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037801 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008643 carbohydrate transport Biological Process
GO:0051260 protein homooligomerization Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0042802 identical protein binding Molecular Function
GO:0051119 sugar transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT3G14770
dosa:Os01g0541800
dosa:Os01g0700100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.415
Rank 1 · TkA04G352380 · TK1151
Lysosome / Vacuole0.225
Rank 2 · TkA04G352380 · TK1151
Endoplasmic reticulum0.187
Rank 3 · TkA04G352380 · TK1151
Cytoplasm0.122
Rank 4 · TkA04G352380 · TK1151
Golgi apparatus0.099
Rank 5 · TkA04G352380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv18-102 aa
PF18600Ezh2_MCSS_fung55-68 aa
PF09843DUF207070-218 aa
PF08285DPM381-133 aa
PF26623Psb3599-127 aa
PF03083MtN3_slv138-222 aa
PF26623Psb35138-147 aa
PF08285DPM3145-194 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G352380PF03083MtN3_slv181026.9e-42142.1
TkA04G352380PF18600Ezh2_MCSS_fung55680.6410.4
TkA04G352380PF09843DUF2070702180.619.0
TkA04G352380PF08285DPM3811330.06414.2
TkA04G352380PF26623Psb35991270.1912.0
TkA04G352380PF03083MtN3_slv1382226.9e-42142.1
TkA04G352380PF26623Psb351381470.1912.0
TkA04G352380PF08285DPM31451940.06414.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LH79Arabidopsis thalianasp|Q9LH79|SWET2_ARATH Bidirectional sugar transporter SWEET268.600%Swiss-ProtHigh
A2WR31Oryza sativa subsp. indicasp|A2WR31|SWT2A_ORYSI Bidirectional sugar transporter SWEET2a58.800%Swiss-ProtHigh
Q5JJY5Oryza sativa subsp. japonicasp|Q5JJY5|SWT2A_ORYSJ Bidirectional sugar transporter SWEET2a58.800%Swiss-ProtHigh
B8A833Oryza sativa subsp. indicasp|B8A833|SWT2B_ORYSI Bidirectional sugar transporter SWEET2b54.900%Swiss-ProtHigh

JBrowse

View in Genome Browser